KEGG   Equus asinus (ass): 106837908Help
Entry
106837908         CDS       T04645                                 

Definition
(RefSeq) fatty aldehyde dehydrogenase-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
eai  Equus asinus (ass)
Pathway
eai00010  Glycolysis / Gluconeogenesis
eai00053  Ascorbate and aldarate metabolism
eai00071  Fatty acid degradation
eai00280  Valine, leucine and isoleucine degradation
eai00310  Lysine degradation
eai00330  Arginine and proline metabolism
eai00340  Histidine metabolism
eai00380  Tryptophan metabolism
eai00410  beta-Alanine metabolism
eai00561  Glycerolipid metabolism
eai00620  Pyruvate metabolism
eai01100  Metabolic pathways
Module
eai_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106837908
   00053 Ascorbate and aldarate metabolism
    106837908
   00620 Pyruvate metabolism
    106837908
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106837908
   00561 Glycerolipid metabolism
    106837908
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    106837908
   00310 Lysine degradation
    106837908
   00330 Arginine and proline metabolism
    106837908
   00340 Histidine metabolism
    106837908
   00380 Tryptophan metabolism
    106837908
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106837908
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     106837908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC PT-HINT
Motif
Other DBs
NCBI-GeneID: 106837908
NCBI-ProteinID: XP_014707152
Position
Un
AA seq 227 aa AA seqDB search
MEHQVQRVRDAFLSGRSRPLRFRLQQLEALRRMLQEREKDIVAAIGADLRKSEFNAYIQE
FLTLLGEIDLVLEKLPEWVKATPAKKNMLIMLDEAYIQPEPLGVVLIIGAWNYPLVLLIQ
PLIGAIAAGNAVIMKPSEVSENTAKILAKLLPQYLDQDLYVVVNGGVEETTELLKQQFDH
ILYTGNTMVGKIIMEAAAKHLTPVTLELGGKSPCYVDRDCDLDVACR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggagcaccaagtccagcgggttcgcgatgccttcctgtccggccggtcgcgaccgctg
aggttccggctgcagcagctggaggccctgcgcaggatgttgcaggagcgcgagaaggac
atcgtggcggccatcggcgccgacctgcgcaagagtgaattcaatgcatacattcaggaa
ttccttactcttcttggggagattgaccttgtgctggagaagcttcctgaatgggttaag
gctacaccagctaagaagaacatgctcatcatgctggatgaggcctacattcagccagag
ccactgggagttgtactgattattggagcttggaactacccccttgttctcctcattcaa
cctctgataggagccattgctgcaggaaatgctgtgattatgaagccttctgaagtaagt
gaaaatacagccaagatcttggctaagctgctccctcagtatttagaccaggacctgtat
gttgttgttaatggtggcgtcgaggagaccacagaacttctcaagcagcaatttgaccac
attttatatacgggaaacactatggttggaaaaattatcatggaagctgctgccaaacat
ctgacccctgtgactcttgaacttgggggtaagagtccgtgctacgttgacagagactgt
gacctggatgtcgcctgcaggtga

DBGET integrated database retrieval system