KEGG   Equus asinus (ass): 106838572Help
Entry
106838572         CDS       T04645                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
eai  Equus asinus (ass)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106838572 (THNSL2)
Enzymes [BR:eai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     106838572 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 106838572
NCBI-ProteinID: XP_014708264
Position
Un
AA seq 422 aa AA seqDB search
MPFTCCPTPPLADLIDRAFSRFRHREVVHLSRLKNGLNVLELWHGVTYAFKDLSLSCTAQ
FLQYFLEKRKKHVTVVVGTSGDTGSAAIESVQGAKNVDIIVLLPKGHCTKIQELQMTTVL
KENVHVFGVEGNSDELDEPIKAVFADVAFVRKHNLMSLNSINWSRVLVQMAHHFFAYFRC
VPSLDAHPLPPVEVVVPTGAAGNLAAGCIAQKMGLPIRLVVAVNRNDIIHRTVQRGDFSL
SKAVKATLASAMDIQVPYNMERIFWLLSGSDSQVTRALMEQFERTQSVSLPKDLHSKLSE
VVTSESVSNETITQTMGRCWEENQYLLCPHSAVAVSYHYQQTDRQQPSPPRCCLAPASAA
KFPEAVLAARLTPETPLEILALEHKETRCTPMRRGDDWTLMLRDTIEDLSRQWRDHCLNA
WE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccttttacctgctgtccaacccctcccctcgcagatctgattgaccgagccttcagc
agattccgccacagggaggtggtccatctgtccaggttgaagaacgggctgaacgtgttg
gagctgtggcatggggtcacgtatgcgtttaaggacctgtccctgagctgcacagcacag
ttcctgcagtacttcctggagaagaggaagaagcatgtcaccgtggttgtgggaacatct
ggggacacagggagtgctgccattgagagtgttcaaggggcaaagaacgtggacatcatc
gttctgctgcccaagggtcactgcacgaagattcaggagctccagatgacaacagtgctg
aaggagaatgtccatgtgtttggagtggagggaaacagcgatgagcttgatgagcccatc
aaggccgtgtttgctgacgtggcttttgtcaggaagcacaatctgatgagtctgaattca
atcaactggtctcgggtcctcgtgcaaatggcccaccacttcttcgcttacttccggtgt
gtgccatccttagacgcacaccccctgccccccgtggaggtggttgtgccaacgggggcc
gctgggaaccttgcagctgggtgcattgctcagaagatgggcctgcccatccgcctggtt
gtggcagtgaaccgcaatgacatcatccacaggaccgtccagcgaggagacttctctctg
tccaaggctgtcaaagcaaccttggcatcagctatggacattcaggtgccctacaacatg
gagaggatcttctggctgctctctggctctgacagccaggtgacaagagccctcatggag
cagtttgaaaggacccaaagtgtgagtctacccaaggacctgcacagcaagctttcagag
gtggtgacgtctgagtcggtgtcgaatgagaccatcacccagaccatgggccgctgctgg
gaagagaaccagtacttgctgtgccctcactcggccgtggccgtgagctaccattaccag
cagacagacaggcagcagcccagccctccccggtgttgtctggcccccgcctctgcagcc
aagttccccgaagctgtcctggctgcccggctgaccccagagactcccttggagatccta
gccctggagcacaaggagacacgttgcaccccaatgcggaggggtgacgactggacactg
atgcttcgggacacaattgaggacctcagccggcagtggagggatcactgcctgaatgcc
tgggaatag

DBGET integrated database retrieval system