KEGG   Equus asinus (ass): 106839159Help
Entry
106839159         CDS       T04645                                 

Gene name
BLVRA
Definition
(RefSeq) biliverdin reductase A
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
eai  Equus asinus (ass)
Pathway
eai00860  Porphyrin and chlorophyll metabolism
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    106839159 (BLVRA)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     106839159 (BLVRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 106839159
NCBI-ProteinID: XP_014709203
Position
Un
AA seq 367 aa AA seqDB search
MKPRPRGSHSPAALSSRPRLPRASPHPPAWRPIRAGLPPPFAGRAAGSPEAAPRARALCP
AAGKPLEEETKMNAEPERKFGVVVVGVGRAGSVRIRDLRNPHPSSAFLNLIGFVSRRELG
SVEGVPQISLEDALSSQEVEVAYICSENSSHEDYIRQFLNAGKHVLVEYPMTLSWAAARD
LWDLAEQKGRVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSG
ISRLTWLVSLFGELSLVSATLEQRKEDQYMKMTVCLETENKRPLTWIEEKAPGLKRNRHL
SFHFKSGSLENMPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLWLAEEIQ
KHCCSKE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccccggccccggggttctcacagcccggctgcgctctcctcccgcccccgcctc
ccccgcgcgtccccgcatcctccggcctggcggccaatccgcgccgggctcccgcccccg
ttcgcagggcgggccgcggggagcccagaggctgcgccccgagctcgagctttgtgccca
gcagcaggtaagccgctggaggaagagaccaagatgaatgcagagcccgagaggaagttt
ggcgttgtggtggttggcgttggcagagccggctccgtgcggataagggacctgcggaat
ccacatccttcatcggcgttcctgaacctgattggcttcgtgtccagacgagaactcggg
agtgttgaaggagtgccccagatttctttggaagatgctctctccagccaagaggtcgag
gttgcttatatctgcagtgagaattccagccatgaggactacatcaggcagtttcttaat
gctggcaagcatgtccttgtggaataccccatgacactgtcttgggcagcagctcgggac
ctgtgggatctggctgagcagaaagggagagtcttgcacgaggagcatgttgaactcttg
atggaggagtttgcattcctgaagaaggaagtggtggggaaagacctgctgaaaggctct
cttctcttcacagctggcccgctggaagaagagcggtttggcttccccgcgttcagtggc
atttctcgcctgacctggctggtctccctctttggggagctttctctcgtgtccgccact
ttggaacagcgaaaggaagatcagtatatgaaaatgactgtgtgcttggagacagagaac
aaacgtccgctcacgtggattgaagagaaggcacctggtctcaaacggaacagacattta
agcttccacttcaaatctgggtccctggagaatatgccaaatgtaggcgtcaataagaat
attttcctgaaagatcaaaatatatttgtccagaaactcttgggccagttctcagaaaag
gaactggctgctgaaaagaagcgcatcctgcactgcctgtggctggcggaggaaatccag
aaacactgctgctcaaaggagtaa

DBGET integrated database retrieval system