KEGG   Equus asinus (ass): 106840352Help
Entry
106840352         CDS       T04645                                 

Definition
(RefSeq) beta-1,4-galactosyltransferase 4-like
  KO
K07969  beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.275 2.4.1.-]
Organism
eai  Equus asinus (ass)
Pathway
eai00533  Glycosaminoglycan biosynthesis - keratan sulfate
eai00601  Glycosphingolipid biosynthesis - lacto and neolacto series
eai01100  Metabolic pathways
Module
eai_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    106840352
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    106840352
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:eai01003]
    106840352
Enzymes [BR:eai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     106840352
    2.4.1.275  neolactotriaosylceramide beta-1,4-galactosyltransferase
     106840352
    2.4.1.-  
     106840352
Glycosyltransferases [BR:eai01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   106840352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 106840352
NCBI-ProteinID: XP_014711222
Position
Un
AA seq 246 aa AA seqDB search
MGCNVTFHLSYKFRLPLLLTLCLTVVGWATRNYFVAALQEIPKAKDFMANFNNPLVLEKK
QTLTNEASTTTANLDNCPSMSPYLRGQNKLFFKPDLTLEEVQAENPNVRRGRYHPEECRA
LQRVAILVPHRNREKHLMYLLEHLHPFLHRQQLEYGIYVIHQAGSKKFNRAKLLNVGYLE
ALKDENWDCFIFHDVDLVPENDLNLYKCEDQPKHLVVGRNSTGYRLRYSGYFGGVTALSR
EQFFKG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcaatgtgactttccacctttcttacaaattccggttaccgttgcttcttacc
ttatgcctgacggtggttgggtgggccaccaggaactactttgtagctgctcttcaagag
attcctaaagcaaaggatttcatggctaatttcaacaaccctctcgttttggagaagaaa
caaactctgaccaatgaagcatccacgacaactgcaaaccttgacaactgcccttccatg
tctccatacctcagaggccagaacaagctctttttcaaaccggatctcactctggaagaa
gtgcaggcagaaaaccccaacgtgcgcagaggacgctatcaccccgaggaatgcagggct
ctgcagcgggtcgccatcctcgttccacaccggaacagggagaagcacctgatgtacctg
ctggaacaccttcatccctttttgcatcggcagcagctggagtacggcatctatgtcatc
caccaggctggaagtaaaaagtttaatcgagccaaactcttgaatgtgggctatctagaa
gctctcaaggatgaaaattgggactgctttatattccacgatgtggatctggtgccggag
aatgacctgaacctttacaagtgtgaggatcagcccaagcatctggtggttggcaggaac
agtactggatacaggttacgttacagcggatattttgggggcgttactgccctaagcaga
gaacaatttttcaagggttga

DBGET integrated database retrieval system