KEGG   Equus asinus (ass): 106840860Help
Entry
106840860         CDS       T04645                                 

Gene name
CACNG7
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 7
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
eai  Equus asinus (ass)
Pathway
eai04010  MAPK signaling pathway
eai04260  Cardiac muscle contraction
eai04261  Adrenergic signaling in cardiomyocytes
eai04921  Oxytocin signaling pathway
eai05410  Hypertrophic cardiomyopathy (HCM)
eai05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
eai05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106840860 (CACNG7)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    106840860 (CACNG7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106840860 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    106840860 (CACNG7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    106840860 (CACNG7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    106840860 (CACNG7)
   05414 Dilated cardiomyopathy (DCM)
    106840860 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:eai04040]
    106840860 (CACNG7)
Ion channels [BR:eai04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106840860 (CACNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Amastin Claudin_3 L_HMGIC_fpl
Motif
Other DBs
NCBI-GeneID: 106840860
NCBI-ProteinID: XP_014711963
Position
Un
AA seq 275 aa AA seqDB search
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtcactgcagcagccgcgccctgaccctgctgagcagcgtgttcggcgcgtgcggc
ctgctgctcgtgggcatcgcggtcagcactgactattggctgtacatggaggagggaacg
gtgctgccgcagaaccagaccacggaggtcaagatggcgctgcatgctggcctctggcgc
gtctgcttcttcgcaggccgagagaagggtcggtgcgtggcctcggaatatttccttgaa
ccggagatcaacctggtgacggaaaacacagagaacattctgaagacagtgcgcacagcc
acccccttccccatggtcagtctcttcctggtgttcacggccttcgtcatcagcaacatt
ggccacatccgcccgcagaggacaattctggccttcgtttctggcatcttcttcatccta
tcgggcctctccttggtggtgggcttggttctttacatttccagcatcaatgacgaggtc
atgaacaggcccagcagctctgagcagtattttcactatcgctacgggtggtcttttgcc
ttcgctgcttcctccttcttactcaaagagggggctggcgtgatgtccgtgtacttgttc
accaagcggtacgcggaggaggagatgtatcgtccgcacccggccttctaccgcccgcgt
ctcagcgactgctccgactactcgggccagttcctgcagcccgaggcctggcgccgcggc
cgcagcccctctgacatctccagcgatgtatccatccagatgacgcagaactaccctccc
gccatcaagtacccggaccacctgcacatctccacctcgccttgctga

DBGET integrated database retrieval system