KEGG   Equus asinus (ass): 106843019Help
Entry
106843019         CDS       T04645                                 

Gene name
PIGT
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
eai  Equus asinus (ass)
Pathway
eai00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    106843019 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 106843019
NCBI-ProteinID: XP_014715351
Position
Un
AA seq 578 aa AA seqDB search
MAAAVRLALIVLLLLGPGGWGHAEPSRDSLREELVITPLPSGDVAATFQFRTRWDSELHR
EEVSHYRLFPKALGQLISKYSLQELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDKSWKELSNVLSGIFCASLNFIDSTNTVIPTASFKPLGLANGTDHYFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNARCTSISWELRQ
TLSVVFDAFVTGQGKKDWSLFRMFSRTLTEPCPLAAESRVYVDITSSKQDNETLEVNPPP
LTTYQDVILGTQKTYAVYDLLDTAVINNSRNLNLQLKWKRPPENEAPPVPFLHAQRYVSG
YGLQSGELSTLLYNTHPYRAFPVLLLDTVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQ
DRLQPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSIVA
SKPVDWEESPLFNTLFPGSDSSSYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHIEEPSKGGLAKRLANLIRRARGIPPL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgtgcggctggcactgattgtgctgctgctcctggggccaggcggctgg
ggccatgcagagccctcacgcgacagcctgcgggaggagctggtcatcaccccgctgcct
tctggggacgtagccgccacgttccagttccgcacgcgctgggattcggagctgcatcgg
gaagaagtgtctcattataggctcttccccaaagccctggggcagttgatctccaagtat
tctctgcaggagctgcacctgtcattcactcaaggcttctggaggactcgatactgggga
ccacccttcctgcaggccccatcaggtgcagagctctgggtctggttccaagacaccgtc
actgatgtggataaatcttggaaggagctcagtaacgtcctctcagggatcttctgtgcc
tctctcaacttcatcgactccaccaacacggtcattcccactgcctccttcaaacccctg
gggctggccaatggcactgatcactatttcctgcgctatgccgtgctgccgcgggaggtt
gtctgcactgagaaccttaccccatggaagaagctcttgccctgtagttccaaggcaggc
ctctctgtgctgctgaaggctgatcgcttgttccacactagctaccactcccaggcagtg
catatccgccctgtttgcagaaatgcacgctgtaccagcatctcctgggagctgaggcag
accctttccgttgtgtttgatgccttcgtcacggggcaagggaagaaagactggtccctc
ttccggatgttctcccggaccctcacagagccctgccccctggctgcagagagccgagtc
tatgtggacatcaccagctctaagcaggacaatgagacgttggaggtgaacccgccccct
ctcaccacataccaggatgtcatcctgggcacccagaagacctatgctgtctacgattta
cttgacacggccgtgatcaacaactcccgcaaccttaacctccagctcaagtggaagaga
cccccagagaatgaggccccaccagtgcccttcctgcacgcccagcggtacgtgagcggc
tatgggctgcagagtggggagctgagcaccctgctgtacaacacccacccctaccgggcc
ttccccgtgctgctgctggacacggtgccctggtacctgcggctgtatgtgcacaccctc
accatcacctccaagggcaaggagaacaagccaagttacatccactaccagcctgcccag
gaccggctgcagcctcacctcctggagatgctgattcagctgccagccaactcagtcacc
aaggtctccatccagtttgagcgggcactgctcaagtggaccgagtacaccccggacccc
aaccatggcttctatgtcagcccatctgtcctcagcgccctcgtgcccagcatcgtagca
tccaaacccgtggactgggaagagagccccctcttcaacaccctcttcccaggctccgac
agctccagctactttgtgcggctctacacggagccgctgctggtgaacctgccgacgccg
gacttcagcatgccctacaatgtcatctgcctcacgtgcacggtggtggccgtgtgctat
ggctccttctacaacctcctcacccgaaccttccacatcgaggagcccagcaagggcggc
ttggccaagcggctggctaacctcatccggcgcgcccgtggcatccccccgctctga

DBGET integrated database retrieval system