KEGG   Equus asinus (ass): 106843297Help
Entry
106843297         CDS       T04645                                 

Gene name
BLVRB
Definition
(RefSeq) biliverdin reductase B
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
eai  Equus asinus (ass)
Pathway
eai00740  Riboflavin metabolism
eai00860  Porphyrin and chlorophyll metabolism
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    106843297 (BLVRB)
   00860 Porphyrin and chlorophyll metabolism
    106843297 (BLVRB)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     106843297 (BLVRB)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     106843297 (BLVRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD TrkA_N Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 106843297
NCBI-ProteinID: XP_014715763
Position
Un
AA seq 207 aa AA seqDB search
MVVKKIALFGATGRTGLTTLAQAVQAGYEVTVLVRDASKLPSEGPQPAHVVVGDVRQAAD
VDKTVAGQDAVVVLLGTGSDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLRDLAT
VPPRLQAVTDDHIRMHNVLKESGLKYVAVMPPHIAGDQPLTGKYSVTLDGRGPSRVISKH
DLGHFMLHCLTTDEYDGHSTYPSHQYE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcaagaagattgcgctcttcggcgccaccggcagaaccgggctcaccacactg
gcgcaggcggtgcaagcaggttatgaagtgacagtgctggtgcgggatgcctccaagctg
ccctcagaggggccccagccagcccacgtggtagtgggcgacgttcggcaggcggctgat
gtggacaagaccgtggctgggcaggacgctgtcgtcgtgctgctgggcaccggcagtgac
ctcagtcctaccacagtgatgtccgagggtgcccggaacattgtggcagccatgaaggcc
catggcgtggacaaggtcgtggcgtgcacctcggccttcctgctacgggacctggccacc
gtgcccccacgactgcaggctgtgactgatgaccacatccggatgcacaacgtgctgaag
gagtcgggcctgaagtacgtggccgtgatgccaccacacatagccggagaccagccgctg
actgggaagtactcagtgaccctggatggacgagggccctcgagggtcatctctaaacac
gacctgggccacttcatgctgcactgcctgactaccgatgagtatgacggccacagcacc
tacccctcccaccagtacgagtag

DBGET integrated database retrieval system