KEGG   Equus asinus (ass): 106843807Help
Entry
106843807         CDS       T04645                                 

Definition
(RefSeq) cytochrome P450 2B4-like
  KO
K07412  cytochrome P450 family 2 subfamily B [EC:1.14.14.1]
Organism
eai  Equus asinus (ass)
Pathway
eai00140  Steroid hormone biosynthesis
eai00590  Arachidonic acid metabolism
eai00830  Retinol metabolism
eai01100  Metabolic pathways
eai05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    106843807
   00590 Arachidonic acid metabolism
    106843807
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    106843807
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    106843807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:eai00199]
    106843807
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     106843807
Cytochrome P450 [BR:eai00199]
 Cytochrome P450, animal type
  CYP2 family
   106843807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 106843807
NCBI-ProteinID: XP_014716496
Position
Un
AA seq 494 aa AA seqDB search
MELSMLLLLVLLMGLLLLLVRGHPKAYGRLPPGPRPLPFLGNLLQMDRRGLLKSFIKLQE
KYGDVFTVYLGPRPTIMLWGTEVIREALVDQAEAFSGRGKIAVIDQVFQGYGVVFANGER
WKTLRRFSLATMKNFGMGKRSVEERIQEEAQFLMEELRNTKGALQDPTFFFHAITANIIC
SIVFGKRFSYRDPEFLRLLDLFYQTFALMSSFSSQVFQLFSDFLKHFPGTHRQVYRNLME
INAFIGHSVEEHRKTLDPSNPRDLIDTYLLRMDKEKSDPNTEFHQQNLIITVLSLFFAGT
ETTSTTLRYGFLLMLKYPHITERVHKEIDLVIGSQRPPALDDRTKMPYTDAVIHEIQRFS
DLLPLGVPHVVTNDTHFRGYIIPKGTEVYPILSSALHDPRYFEKPDAFNPDRFLDASGAL
KKNEAFIPFSTGKRTCLGEGIARTELFLFFTTILQNFSVASPAAPEDIDLTPRESGVGRI
PPIYQISFLPRRGG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagcatgctcctcctccttgttctcctcatgggactcttgcttctcctggtc
aggggccacccaaaagcctacggccgcctcccaccaggaccccgtcctctgcccttcttg
gggaaccttctgcagatggacagaagaggcctactcaaatccttcataaagcttcaagag
aaatatggggatgtcttcacggtgtacctggggccaaggcctacaatcatgctgtggggg
acagaggtcatccgggaggccctggtggaccaagctgaagcattctctggccgggggaaa
atcgctgtcattgaccaagtcttccaggggtatggtgtggtctttgccaatggagaacgt
tggaagacccttcgacgattctccctggccaccatgaagaacttcgggatgggaaagcgg
agtgtggaggagcggattcaggaggaggctcagtttctgatggaggagctgcggaatacc
aagggagccctccaggatcccaccttcttcttccatgccatcaccgccaacatcatctgc
tccattgtctttgggaaacgcttctcctacagagatcctgagttcctgcggctcctggac
ttgttctaccagacctttgcgctcatgagctccttctccagtcaggtgttccagctcttc
tctgacttcctgaagcactttcctggcacacacaggcaggtctacagaaatctgatggaa
atcaatgccttcattggccacagtgtggaggagcaccgcaaaaccttggaccccagcaat
ccccgagacctcattgatacctacctgctccgcatggacaaagagaagtctgaccccaac
accgagttccaccagcaaaacctcatcatcactgtgctctcactcttcttcgctggcact
gagaccactagcacgactctccgctatggattcctgctcatgctcaaatacccccacatc
acagagagagtccacaaggagattgatctggtgattggctcacaacgccctccagccctt
gatgaccgcaccaaaatgccatacactgatgcagtcatccatgaaattcagagattctca
gacctcctcccccttggggtgccccacgttgtcaccaacgacactcacttccgagggtac
atcatccccaagggcactgaagtatatcccatcctgagctctgctctccatgacccacgt
tactttgagaaaccagacgccttcaaccctgaccgctttctggatgccagtggggcactg
aagaagaatgaagcttttatccccttctccacagggaaacgcacttgtcttggagaaggc
atcgctcgcaccgaattattcctcttcttcaccaccatccttcagaacttctccgtggcc
agccccgctgcccctgaagacattgacctcacaccccgggaaagtggtgtgggcagaata
cccccaatataccagatcagcttcctgccccgtcgagggggctaa

DBGET integrated database retrieval system