KEGG   Equus asinus (ass): 106844524Help
Entry
106844524         CDS       T04645                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
eai  Equus asinus (ass)
Pathway
eai04010  MAPK signaling pathway
eai04014  Ras signaling pathway
eai04015  Rap1 signaling pathway
eai04022  cGMP-PKG signaling pathway
eai04066  HIF-1 signaling pathway
eai04068  FoxO signaling pathway
eai04072  Phospholipase D signaling pathway
eai04150  mTOR signaling pathway
eai04151  PI3K-Akt signaling pathway
eai04152  AMPK signaling pathway
eai04211  Longevity regulating pathway
eai04213  Longevity regulating pathway - multiple species
eai04520  Adherens junction
eai04910  Insulin signaling pathway
eai04913  Ovarian steroidogenesis
eai04923  Regulation of lipolysis in adipocytes
eai04930  Type II diabetes mellitus
eai04931  Insulin resistance
eai04932  Non-alcoholic fatty liver disease (NAFLD)
eai04960  Aldosterone-regulated sodium reabsorption
Module
eai_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106844524 (INSR)
   04015 Rap1 signaling pathway
    106844524 (INSR)
   04010 MAPK signaling pathway
    106844524 (INSR)
   04066 HIF-1 signaling pathway
    106844524 (INSR)
   04068 FoxO signaling pathway
    106844524 (INSR)
   04072 Phospholipase D signaling pathway
    106844524 (INSR)
   04022 cGMP - PKG signaling pathway
    106844524 (INSR)
   04151 PI3K-Akt signaling pathway
    106844524 (INSR)
   04152 AMPK signaling pathway
    106844524 (INSR)
   04150 mTOR signaling pathway
    106844524 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106844524 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106844524 (INSR)
   04923 Regulation of lipolysis in adipocyte
    106844524 (INSR)
   04913 Ovarian Steroidogenesis
    106844524 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    106844524 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    106844524 (INSR)
   04213 Longevity regulating pathway - multiple species
    106844524 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    106844524 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    106844524 (INSR)
   04931 Insulin resistance
    106844524 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eai01001]
    106844524 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:eai04090]
    106844524 (INSR)
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106844524 (INSR)
Protein kinases [BR:eai01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   106844524 (INSR)
CD molecules [BR:eai04090]
 Proteins
  106844524 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476 MVL
Motif
Other DBs
NCBI-GeneID: 106844524
NCBI-ProteinID: XP_014717501
Position
Un
AA seq 1344 aa AA seqDB search
MDIRNNLTRLHELANCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLE
SLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLAT
IDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQK
VCPTICKSHGCTADGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQD
WRCVNFSFCQDLHNKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPK
VCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKI
RRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHY
NPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLTFSHIRTSSDKILLKWE
PYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPG
WLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTNATNPSVPLDPISVSNSSSQ
IILKWKPPSDPNGNITHYLVFWERQEEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKH
NQSEYEESAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKSSSGPGAEDTRP
SRKRRALADVGNVTVAVPTVPGFPNTSSTSTPTSSEERRPFEKVVNKESLVISGLRHFTG
YRIELQACNQDSPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEP
NGLIVLYEVSYRRYGDEELHLCVSRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSWT
EATYFYVTDYYVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPE
YLSASDVFPCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKT
VNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSL
RPEAENNPGRPPPTLQEMVQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDF
GMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQ
GLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSF
PEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHSQREEAGGRDAGSSLGLKRNYEEH
IPYTHMNGGKKNGRILTLPRSNPS
NT seq 4035 nt NT seq  +upstreamnt  +downstreamnt
atggatatccggaacaacctcacgaggctgcacgagctggccaactgctccgtcattgaa
ggacacttgcagattctgttgatgtttaaaacgaggcctgaggatttccgagacctcagt
ttccccaaactcatcatgatcactgattacttgctgctcttccgggtgtacgggctggag
agcctgaaggacctgttccccaacctcacggtcatccggggctctcgcctcttcttcaac
tacgcgctggtcatcttcgagatggttcacctgaaggagcttggcctctacaacctgatg
aacatcacccgcggctccgtccgcatcgagaagaacaacgagctgtgctacctggccacc
attgactggtcgcgcattctggactcggtggaagataattacatcgtgctgaacaaggac
gacaatgaggagtgcggggacatttgtccaggcaccgccaagggcaagaccaactgcccc
gctactgtcatcaacggacagtttgttgagcggtgctggacgcacagccattgccagaaa
gtttgcccgaccatctgtaagtcacacggctgcaccgcggacggcctctgctgccacagc
gagtgtttaggcaactgctctgagcccgacgaccccaccaagtgcgtggcctgccgcaac
ttctacctggacggcaggtgtgtggagacctgcccgcccccgtactatcacttccaagac
tggcgctgtgtgaacttcagcttctgccaggacctgcacaacaaatgcaagaactcccga
aggcagggctgccatcagtacgtcattcacaacaacaagtgcatccctgagtgtccctct
gggtacacgatgaattccagcaacttgatgtgtaccccgtgcctgggtccctgtcccaag
gtgtgccacctcctggaaggcgagaagaccatcgactcggtgacgtccgcccaggagctc
cgaggctgcacggtcatcaacgggagcctgatcatcaacatccgagggggcaacaacctg
gcagctgagctagaggccaacctcggactcattgaagaaatttcagggtatctgaaaatc
cgccggtcctacgctctcgtgtcgctttccttcttccggaagttacgcctaattcgggga
gagaccttggaaatcgggaactactcattctacgccttggacaaccagaacctgaggcag
ctatgggactggagcaagcacaacctcaccatcactcaggggaaactcttcttccactat
aatcccaaactctgcttgtcggaaattcacaagatggaggaagtttcaggaaccaaaggg
cgccaggagaggaacgacatcgccctgaagaccaacggggaccaggcatcctgtgaaaat
gagttacttacattttctcacattcggacatcttctgacaagatcttgctgaaatgggag
ccgtattggccccccgacttccgagacctcttgggcttcatgctcttctataaagaggcc
ccttatcagaacgtgacggagttcgatgggcaggatgcgtgtggctccaacagctggacg
gtagtggacattgacccacctctgaggtccaacgaccccaagtcacagaaccaccctggg
tggctgatgcgaggtctcaaaccctggacccagtacgccatctttgtcaagaccttggtc
accttttctgatgaacgccggacatacggggccaagagcgacatcatctatgtccagaca
aatgccacgaacccgtctgtccccctggatcccatctccgtttctaattcctcgtcccag
attattctgaaatggaagcccccctctgaccccaatgggaacatcacacactacctggtt
ttctgggagaggcaggaggaagacagcgagctgtacgagttggattattgcctcaaaggc
ttgaagctgccctccaggacctggtctccaccgtttgagtctgaggggtcccagaagcac
aatcagagtgagtacgaggagtctgccggcgaatgctgctcctgcccgaagaccgactcc
cagatcctgaaggagctggaggagtcctcgttcaggaagacgttcgaggactatctgcac
aatgtggtttttgtccccagaaaatcctcttcaggccctggtgccgaggacactagaccg
tctcggaaacgcagggcgcttgctgatgtcgggaatgtgacggtggccgtgcccacggtt
ccgggtttccctaatacctcctccaccagcacgcccacgagctcagaggagcgcagaccc
ttcgagaaagtggtgaacaaggagtcgctggtcatctccggcctgcgccattttaccggc
tatcgcatcgagcttcaggcttgcaaccaagattcccccgaagagaggtgcagtgtggct
gcctatgtcagtgccaggaccatgcccgaagccaaggcggacgacatcgttggccccgtg
actcacgaaatcttcgagaacaatgtcgttcacttgatgtggcaggagcccaaagaaccc
aacggtctgattgtgctgtacgaagtgagttatcgacgatacggcgatgaggagctgcat
ctctgtgtgtctcgcagacattttgccctggagcggggctgccggctgcgcgggctgcca
ccggggaactacagtgtgcgagtgcgggccacctccctggcaggcaacggctcctggacc
gaagccacttatttctacgtgacagactattacgtcccatcaaatattgcaaaaatcatc
atcggccccctcatctttgtctttctcttcagtgtggtcattggaagcatttacctcttc
ttgagaaagaggcagccggatgggcccctgggaccgctgtacgcttcctcaaaccctgag
tacctcagcgccagtgatgtgtttccctgctctgtgtacgtgccggacgagtgggaggtg
cctcgggagaagatcaccctcctgcgggagctggggcagggctccttcggcatggtgtat
gaaggcaacgccagggacatcgtcaagggcgaggcggagacccgcgtggcggtgaagacg
gtcaacgagtctgccagtctgcgagagaggatcgagtttctcaacgaggcctcagtcatg
aagggcttcacctgccatcatgtggtccgcctcctgggggtggtatcgaaaggccagcca
acgctggtggtgatggagttgatggctcacggagacctgaagagctacctccgttccctg
cggccggaggctgagaataaccctggtcgccctccccctaccctgcaagagatggttcag
atggcggcggagatcgccgacgggatggcgtacctgaacgctaagaagtttgtgcaccgg
gacctggcagctcgaaactgcatggtcgcccacgattttaccgtcaaaatcggagacttt
ggaatgaccagagacatctacgaaacggattactaccggaaaggaggcaaggggctgctc
cctgtgaggtggatggctcctgaatccctgaaggacggggtctttactacttcttctgac
atgtggtcctttggcgtggtcctttgggaaatcaccagcttggcagaacagccttaccaa
ggcctgtctaatgagcaggtgttgaaatttgtcatggatggagggtatctggatcaaccc
gacaattgtcccgagagagtcaccgacctgatgcgtatgtgctggcagttcaaccccaag
atgcggccgaccttcctggagatcgtcgacctgctcaaggatgacctgcaccccagcttt
ccagaagtttccttcttccacagcgaggagaacaaggcccccgagagcgaggagctggag
atggagtttgaggacatggagaatgtccccctggatcggtcctcacattcccagagggag
gaggccgggggccgggatgcagggtcctctctgggtctaaagcggaactatgaggaacac
atcccgtacactcacatgaacgggggcaagaaaaacgggcggattctgactctgccgagg
tcaaatccttcctaa

DBGET integrated database retrieval system