KEGG   Equus asinus (ass): 106844773Help
Entry
106844773         CDS       T04645                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  arginase [EC:3.5.3.1]
Organism
eai  Equus asinus (ass)
Pathway
eai00220  Arginine biosynthesis
eai00330  Arginine and proline metabolism
eai01100  Metabolic pathways
eai01230  Biosynthesis of amino acids
eai05146  Amoebiasis
Module
eai_M00029  Urea cycle
eai_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    106844773 (ARG2)
   00330 Arginine and proline metabolism
    106844773 (ARG2)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106844773 (ARG2)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     106844773 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 106844773
NCBI-ProteinID: XP_014717907
Position
Un
AA seq 342 aa AA seqDB search
MSLGSSLSRLLRTQVHSVLKKAVHSVAVIGAPFSGGQKRKGVEHGPAAVREAGLMKRLSN
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSKAVSGGYSCVTVGGDH
SLAIGTISGHARHCPDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQEEVPQLPG
FSWIKPCISSPSIVYIGLRDVDPAEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGIYITEEIHNTGLLSALDLVEVNPW
VAASEEEAKATAVLAVDVIASSFGQTREGEGTLSMTNFLLTR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggggagcagcctctcgcgtctcctccggacgcaagtgcattccgtcctgaag
aaggctgtccactccgtggctgtgatcggagccccgttctcagggggacagaagagaaaa
ggagtggaacatggtcccgctgctgtaagagaagctggcttgatgaaaaggctctccaat
ttgggttgtcacctaaaagactttggcgatttgagttttactcctgtccccaaagatgat
ctctacaacaacctgatagtgaatcctcgctcagtgggccttgccaaccaggaactggct
gaggtggttagtaaagccgtgtcaggtggctacagctgtgtcacagtgggaggggaccac
agcctggcaattggtaccattagtggccacgcccggcactgcccagacctttgtgtgatc
tgggttgatgcccatgctgacatcaatacaccgctcaccacttcatctggaaatctccac
gggcagccagtttcattcctcctcagagaactacaggaggaggtaccacaactcccagga
ttttcctggatcaaaccttgtatttcttccccaagtattgtgtatattggtctaagagat
gtggaccctgctgaacattttattttaaagaattatgatatccagtatttttccatgaga
gacatagatcgacttggtatccagaaggtcatggaacagacatttgatctgctgattggc
aaaagacaaaggccaatccatctgagttttgatatcgatgcatttgaccctacactggct
ccagccacaggaacccctgttgtagggggactgacttatcgagaaggcatatatattact
gaggaaatacacaatacagggttgctgtcagcactggatcttgttgaagtcaatccttgg
gtggctgcttcagaggaagaggccaaggctacagctgtcctagcagtggatgtgattgct
tcaagttttggtcagacaagggagggggagggcacactgtctatgaccaacttcctactc
accagatga

DBGET integrated database retrieval system