KEGG   Equus asinus (ass): 106845293
Entry
106845293         CDS       T04645                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
eai  Equus asinus (ass)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eai01002]
    106845293 (ADAMTS13)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     106845293 (ADAMTS13)
Peptidases and inhibitors [BR:eai01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   106845293 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 TSP1_spondin Reprolysin_3 ADAM_spacer1 Reprolysin_4
Other DBs
NCBI-GeneID: 106845293
NCBI-ProteinID: XP_014718763
Position
Un
AA seq 1613 aa
MSELQLWGRCVQGILTSAFLLLGCWGLSDFQQQFLQALEPEEVTSYFGPDTTVKVPRFDV
APLTCVCEDGLRGPRCRDPRCSLRALGQLFTFSFGPELGILAASFISERMVNASFQLLRG
PPHHCFTGGRALLPPGTVARATYCSGHLEGDILVGADRLYVQPVRRQHRQLVPHWGGAQP
HLIHRLAPMAPMVPGVIQGRPPSPRLQRRAAGSILHLELLVAVGPDVYQAHQDDTERYVL
TNLNMGSELLRDPSLGAEFRVHLVKMVILTRPEDAPDITANITSSLRSVCEWSRTVNPQD
DTDPRHADLVLYITRFDLELPDGNRQVRGVTQLGGACSSSWSCLITEDTGFDLGVTIAHE
IGHRVGSWSGATAENAHPRPCEPTPPNVLNSCAHSFIPPPPGVPPGPEPGPCRSAGRARC
VWDPPGLQPRSSGHPPEGHPGLYYGADEQCRVTFGPTAVACTFTREHLDMCQALSCHTDP
LDQSSCSRLLIPLLDGTECGVDKWCSKGHCRSLAELSPVGAVHGHWSGWGLPSPCSRSCG
GGVVTRRRQCNNPRPAFGGRACVGADLQAEMCNTQACEKTQLEFMSEQCAETNGKPLSLS
PGGTSFYRWDAAARYSQGDALCRHMCRAVGESFIVRRGDSFLDGTRCVPSGWQEDGTLSL
CVSGHCRTFGCDGRMDSQQVRDVCQVCGGDNSTCSRQSGSFTAGRAREYVTFLTVTPNLT
SIYVANQRPLFTHLAVRIRGRYVVAGNSSISPSTTYPSLLEDSRVEYKVTLTEDRLPRRE
EIRIRGPTQEDMEIQVYRRYGEEYGELTRPDVTFTYFQPKQRQAWAWAAVRGPCSVSCGA
GLRWVTYGCLDQARNEWVEPAHCGGSRQPAAWQESCALKPCPPYWAAGDFGPCSASCGGG
LRERAVRCVEAQGGLLRTLPLAQCRALALQPELVETCNSQPCPPRWEESNACSSSCGAER
AAQNMTCVPGADGLEVPATAGPCSPDEKLPTLKPCVAMACPPTWGHLDPQAPGEEAASPS
GSARLEAHIAHVWMPLAGTCSVSCGRGLRELHFVCMDSAIRTPVREELCDLASKPGSRQE
VCQAVPCPARWETRALAPCPVTCGGGQVLLAVRCVRPDRGHLVPLPHSKCWPVPRPSPFK
DCSPEPCPARWRYKLAACSVSCGGGVVRRIPYCARAQGEDKDEEILPDAQCQGLPRPEQQ
EACSPEPCPPRWKVMSLGPCSASCGLGTATRSVACVQRDQGRDVEVDGAACAALVQPQAS
IPCVTADCSYRWHVSPWMQCSVSCGDGIQRRHDACLGPQAQVPVPADFCQHLPKPATVRG
CWAGPCERQGTPSPVPHEEATAPGQTTPATADASPEQPQRQTPLSSPGSWLPPRPQESPV
ESSACGRQHLEPTGTIDMRGPGRVDCAVAIGRPLGEVVTLQVLESSLNCSTGEMLLLWGR
LTWRKMCRKLSGMTFSSKANTLVVRQRRVRPGGGVVLRYSSRPAPETFHGDCDTQLFGPW
GEIVSPLMSPDGRNVGGCRVFIDVAPRARIAIHALVTNRATGTEGTDASYILIRDIHSLR
TTTFRGQQALYWESEGSRAEMEFSQGFLEAQASLRGQYWTLRSRAQERGRTLP
NT seq 4842 nt   +upstreamnt  +downstreamnt
atgagcgaacttcagctctggggaagatgcgtgcagggaatcctcacttctgccttcctt
ctcctgggctgctggggactctctgatttccagcagcaatttctccaggctttggaacca
gaggaagtgacttcttactttggtcctgacactactgtaaaagtgccccgattcgatgtg
gccccactcacctgtgtctgcgaggatgggctcagggggccacgctgcagggaccctcgc
tgctccctgcgcgccctgggacagctctttaccttctccttcgggcccgagctgggcatc
ctcgctgcctccttcatcagcgagcgcatggtgaacgcctccttccagctgctgaggggg
ccaccccaccactgcttcacgggaggccgcgccctgctgccccccggcacagtggccagg
gccacctactgctcgggtcacttggagggcgacatcctggtgggtgcagacaggctttac
gtccagccggtgaggaggcagcaccggcagctggtgcctcactggggcggtgcccagccc
cacctgatccacaggctcgcccctatggcccccatggtcccaggggtcatccaaggccgt
cctccttcccctcgcctccagagacgggctgctgggagcatcctgcacctggagctgctg
gtggctgtgggccccgacgtctaccaggctcaccaggatgacacggagcgctacgtgctc
accaacctcaacatggggtcagaactgctgagggacccatccctgggcgctgagttccga
gtgcacctggtgaagatggtcatcctgacgcggcccgaggatgctccagatatcacagcc
aacatcacctcgtcactgcggagcgtctgtgagtggagcaggacggtcaacccccaggac
gacacggatcccaggcatgccgacctggttctctacatcaccaggtttgacctggagttg
cctgatggcaaccggcaggtgcggggggtcacccagctggggggtgcctgctcctcctct
tggagctgcctcatcactgaggataccggcttcgacctgggggtcaccatcgcccatgag
attgggcacagagtcggctcttggtctggggcaacggctgagaacgcccatccccgccca
tgcgagcccacccctccaaacgtgctcaactcctgcgcccactctttcattccgccccca
cccggtgttcccccggggcctgagccggggccttgtcgcagcgcaggacgggcgcgctgc
gtgtgggacccaccggggctgcagccccggtcctcggggcaccctcccgaggggcacccc
ggcctctactacggcgctgacgaacagtgccgcgtcaccttcggccccacagcggtcgcc
tgcaccttcaccagggagcacctcgacatgtgccaggctctctcctgccacacagacccc
ctggaccaaagcagctgcagccgcctcctcattcctctcctggatgggacagagtgtggc
gtggacaagtggtgctccaagggtcactgccgctcgctggcggagctgagtcctgtgggg
gccgtgcacgggcactggtctggctggggtctccctagcccttgctcccgctcctgtgga
ggaggtgtagtcaccaggaggcgacagtgtaacaaccccagacctgcctttggtgggcgt
gcctgcgtcggtgctgacctccaggcggagatgtgcaacactcaggcctgcgagaagacc
cagctggagttcatgtcagagcagtgcgctgagaccaacgggaagccgctgtccctctcc
ccgggcggcacgtccttctaccgctgggacgccgctgcacggtacagccaaggggatgct
ctgtgcagacacatgtgccgggctgttggcgagagcttcattgtgaggcgtggggacagt
ttcctggatgggacccgatgtgtgccaagcggctggcaggaggacgggaccctgagcctg
tgtgtgtcgggccactgcaggacgttcggctgtgatggcaggatggactcccagcaggtg
cgagacgtgtgccaggtgtgtggaggggacaacagcacgtgcagccgacagagtggctcc
ttcacggccgggagagccagagagtacgtcaccttcctgacagttacccccaacctgacc
agtatatacgtcgccaatcagaggcctctcttcacgcacttggcagtgaggatccgaggg
cgctacgtcgtggccgggaattcgagcatctctcccagcaccacctacccctccctcctg
gaggacagccgtgtcgagtacaaagtgaccctcactgaggaccggctgccccgccgggag
gagatccgcatccggggacccacccaggaagacatggagatccaggtttacaggcgctac
ggcgaggagtatggcgaactcacccgcccagacgtcaccttcacctacttccagcctaag
cagcggcaggcctgggcatgggccgccgtgcgggggccctgctcggtgagctgtggggca
gggctgcgctgggtgacctacggctgtctggaccaggccaggaacgagtgggtggagcct
gcccactgcggagggagccggcagccagcggcatggcaggagtcctgtgccctcaagccc
tgccccccgtactgggcagctggagactttggcccctgcagcgcctcctgtgggggaggt
ctgcgggagcgggcagtgcgctgcgtggaggcccagggcggcctcctgaggacattgccc
ctggcccagtgcagagcgctagccctgcagccagagctggtggaaacctgtaactcccag
ccctgccctcccaggtgggaggagtccaacgcatgctcatcgtcctgtggagcagaacgg
gctgcacagaacatgacatgcgtgccgggggcagatggcctggaggtgccagcgactgct
gggccctgctccccggatgagaagctacctaccctcaagccctgtgtggccatggcctgt
cctcccacctggggccatctggaccctcaggctccaggagaggaggctgcatccccatca
ggcagtgccaggctggaggctcacattgcacacgtgtggatgcccctggcgggaacttgc
tctgtctcctgtggtcgaggcctgagggagctgcattttgtgtgcatggacagtgccatc
aggacacccgtccgggaagagctttgtgacctggcaagcaagcctgggagccggcaggag
gtgtgccaggctgtcccatgcccggctcggtgggagacccgagccttggcaccgtgccca
gtgacctgtggaggggggcaggtgctgctggctgttcgctgtgtgaggccggaccgtggc
cacttagtccccctgcctcattccaagtgctggccagtgccccggcccagccccttcaag
gactgcagcccggagccctgccctgccaggtggcggtacaagctggcggcctgcagcgtg
agctgtgggggaggggttgtgcggaggatcccgtattgtgcccgggcccagggggaggac
aaggatgaggagatcctgccagacgcccagtgccaggggctgcctcgccctgagcagcag
gaggcctgcagcccggagccctgcccacccaggtggaaagtcatgtccctgggcccatgc
tcggctagctgtggtcttggcaccgccacacgctccgtggcctgtgtgcagcgggaccaa
ggccgggacgtggaggtggatggggcagcctgtgcagctctggtgcagccacaggccagc
atcccctgtgtcactgccgactgctcctaccggtggcatgtcagcccctggatgcagtgc
tccgtctcctgtggggatggcatacagcgccggcacgacgcctgccttggaccccaggcc
caggtgcccgtgccagctgacttctgccagcacttgcccaagccagcgacggtgcggggc
tgctgggccgggccctgtgaaaggcaggggacgcccagcccggtgccccacgaggaagcc
actgctccaggccagaccacgcctgccactgcggatgcttccccagagcagccccagcgc
cagacgcccctctcctccccaggttcctggctcccacccaggccccaggaaagcccggtg
gagtccagtgcctgtggccggcagcaccttgagccaacaggaaccattgacatgcgaggc
ccagggcgggtggactgtgcagtggccattgggcggcccctgggtgaggtggtgaccctc
caagtcctcgagagttccctcaactgcagcaccggggagatgctgctgctctgggggcgg
ctcacatggaggaagatgtgcaggaagctgtccggcatgaccttcagctccaaagccaac
acactcgtggtgaggcagaggcgcgtgcggccgggaggtggcgtggtactgcggtattcc
agccggcctgccccagaaaccttccacggagattgtgacacgcagctctttggaccctgg
ggtgaaatcgtgagcccgttgatgagtccagatgggaggaatgtggggggctgccgtgtc
ttcatcgacgtggctccacgggcccggatcgcaatccatgccctagtcaccaacagggcc
accggaaccgagggaaccgatgccagctacatcttgatccgggacatccacagcctgagg
acgacgacattccgtgggcagcaggcgctctactgggagtcagagggcagccgggctgag
atggagtttagccagggcttcctggaggcacaggccagcctgcggggccagtactggacc
ctccgatctagagcccaggagcgcggcaggaccctgccctag

DBGET integrated database retrieval system