KEGG   Equus asinus (ass): 106846629Help
Entry
106846629         CDS       T04645                                 

Gene name
DOCK6
Definition
(RefSeq) dedicator of cytokinesis 6
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
eai  Equus asinus (ass)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eai04131]
    106846629 (DOCK6)
Membrane trafficking [BR:eai04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    106846629 (DOCK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 106846629
NCBI-ProteinID: XP_014721016
Position
Un
AA seq 2277 aa AA seqDB search
MLLKPQDPWTRCGGECGAGKVLEPLVLALLPVMGAVTCPTPKGTDFDHQPPRVRTVAAEV
RKQVSRERSGSPHSSRRSSSSLGVPLTEVVEPLDFEDVLLSRPPDAEPGPLRELVEFPAD
DLELLLRPRECRTTEPGIPEEGKLDAQVRAAVEMYTEDWIIAHRRYQHLSAAYSPITTET
QRERQRGLSRQVFEQDASGDEKASPEDADDPRHCSGSPDDTPRSSGASGIFDLRNLAADS
LLPSLLERAAPEDVDRRNEALRRQNRPRALLALYPAPDEDEAVERCSHPEPPQEHFGQRI
LVKCLSLKFEIEIEPIFGILALYDVREKKKISENFYFDLNSDSMKGLLRAHGTHPAISTL
ARSAIFSVTYPSPDIFLVIKVPAGAGRGGDHGRHHRCGPCSPSVSPRGADQGCRGGSTGS
SGPRGGPWPNPGREKSPRASVERWPLSQDTCVGSPRRNGALALADRRLKWLFKLRVFQFI
RRGKISLAHLCGISVSRSELKFPFPKHSVRGGAGTGPPGGEGPTGRGRGYGEGSDALCWL
DSVQAESPPLISVSSITDPASPGAPPLPPHFCLSSLSPPSLTPPPLERRSTWTDRRRRGP
QDRTSSGDDACSFSGFRPATLTVTNFFKQEAERLSDEDLFKFLADMRRPSSLLRRLRPVT
AQLKIDISPAPENPHFCLSPELLHVKPYPDPRGRPTKEILEFPAHEVYAPHTSYRNLLFV
YPHSLNFSSRQGSVRNLAVRVQYMAGEDPSQALPVIFGKSSCSEFTREAFTPVVYHNKSP
EFYEEFKLRLPACVTDNHHLLFTFYHISCQPRPGTALETPVGFTWIPLLQHGRLRTGPFC
LPVSVDQPPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAVSSVHPQDPHLDKFFTLVHV
LEEGAFPFRLKDAVLSEGTVEQELRASLAALRLASPEPLVAFSHHVLDKLVRLVVRPPII
GGQIVNLGRGAFEAMAHVVSLVHRSLEAAQDARGHCPLLAAYVHYAFRLPGTEPSLPGGA
PPVTVQSTTLARGPGRPASLYLARSKSISSSNPDLAVAPGSVDDEVSRILASKGIDRSHS
WVNSAYAPGGSRAVLRRAPPYCGADPRQAIDHCSSRPSSYFEGSSLAPPATQPRPTVQKL
LHEELALQWVVSGSTVREAILQHAWFFFQLMVKSMTLHLLLGQRLDTPRKLRFPGRFLDD
IAALVGSVGLEVITRVHKDAELAERLNASLAFFLSDLLSLTDRGFVFSLVRAHYKQVATR
LLSAPNPVALLTLRMDFTRILCSHEHYVTLNLPCCPLSPPASPSPSISSTTSQSSTFSSQ
APDPKVTSMFELSGPFRQQHFLAGLLLTELALALEPEAEGVSLLHKKAISAVHSLLCGHD
ADPRYTDATVKARVAELYLPLLSLARDTLPRLHDFAEGPGQRSRLASMLDSDTEGEGDIG
GTINPSVAMAIAGGPLAPGSRASISQGPATASRSGCPLSAESSRTLLVCVLWVLKNAEPA
LLQRWAADLALPQLGRLLDLLYLCLAAFEYKGKKAFERINSLTFKKSLDMKARLEEAILG
TIGARQEMVRRSRERSPFGNQENVRWRKSITHWKQTSDRVDKTKDEIEHEALVDGNLATE
ASLVVLDTLEIIVQTVMLSEARESILGAVLKVVLYSLGSAQSALFLQHGLATQRALVSKF
PELLFEEDTELCADLCLRLLRHCGSRVSAIRTHASASLYLLMRQNFEIGNNFARVKMQVT
MSLSSLVGTTQNFSEEHLRRSLKTILTYAEEDVGLRDSTFAEQVQDLMFNLHMILTDTVK
MKEHQEDPEMLIDLMYRIARGYQGSPDLRLTWLQNMAGKHAELGNHAEAAQCMVHAAALV
AEYLALLEDSRHLPVGCVSFQNISSNVLEESAISDDILSPDEEGFCSGKHFTELGLVGLL
EQAATYFTMGGLYEAVNEVYKTLIPILEAHRDYKKLAAVHGKLQEAFTKIMHQPQRVFGT
YFRVGFYGSRFGDLDEQEFVYKEPSITKLAEISHRLEEFYTERFGEDVVEIVKDSNPVDK
AKLDPQKAYIQITYVEPHFDTYELKDRVTYFDRNYGLRTFLFCTPFTPDGRAHGELPEQH
KRKTLLSTDHAFPYIKTRIRVCHREETVLTPVEVAIEDMQKKTRELAFATEQDPPDAKML
QMVLQGSVGPTVNQGPLEVAQVFLTEIPEDPKLFRHHNKLRLCFKDFCKKCEDALRKNKA
LIGPDQKEYHRELERNYTRLREALQPLLTQRLPQLLAPTTASLRNSLHRASFRKADV
NT seq 6834 nt NT seq  +upstreamnt  +downstreamnt
atgctcttgaagccccaagacccctggacccgctgtgggggtgagtgtggggcggggaag
gttctggaacccctggtcctggccctgctccccgtcatgggcgctgtgacgtgcccaacg
ccgaagggcaccgacttcgaccaccagccgcccagggttcggacggtggccgccgaggtg
cggaagcaggtgtcccgggagcgcagtggctccccgcactccagccggcgcagcagcagc
tccctgggagtccccctgactgaagtcgtggagcccctggacttcgaggacgtgctcctg
agccggccgcccgatgccgagcccgggcccctccgcgagctggtggagtttccagccgat
gacctggagctgctgctgcggccccgcgagtgccggaccaccgagcccgggatccctgag
gaggggaagctggatgcccaggtgagggcggcggtggagatgtacacggaagactggatt
attgcccacaggaggtaccagcacctgagcgcggcctacagccccatcaccaccgagaca
cagcgagagcggcagagaggcctcagccgccaggtctttgagcaggacgcctccggggac
gagaaggccagcccggaggacgcggatgacccccggcactgctcggggtccccggatgac
accccgcggagcagcggcgcctctggcatcttcgacctgaggaacctggcggccgactct
ctgctgccctcgctgctggagcgcgcggccccggaggacgtggaccggcgcaacgaggcc
ctgcggaggcagaaccgcccgcgcgccctgctcgccctctacccggcacctgatgaggac
gaggccgtggaacgctgcagccacccggagccgccccaagagcacttcggacagaggatc
ctggtcaagtgtctgtcgcttaagttcgagatcgaaattgagcccatctttggcatcttg
gccctgtatgatgtgcgggagaagaagaagatctcggagaacttctacttcgacctgaat
tcggactccatgaaggggctgctgcgggcccacggcacccaccccgccatctccaccctg
gcccgctccgccatcttctctgtgacctacccctcgccagacatcttcctggtcatcaag
gtgcccgctggggctgggcgggggggtgatcatggcagacaccacaggtgtggtccctgc
tctcctagcgtgtcaccaaggggggcagatcagggctgtcgtgggggaagcacaggcagc
tctgggcccagaggaggcccctggcccaacccaggtcgggagaaatcaccaagggcttcc
gtggagaggtggccgctgagccaagacacatgtgtagggagcccgaggagaaatggcgcc
ctggcacttgcggaccgccgtctaaaatggctttttaagttgagagtgttccagtttatc
aggagaggaaagatctcgttggcacatttgtgtgggatttctgtttccaggagtgagctc
aaatttcctttcccaaaacattcagtcaggggcggggctgggactgggccgccgggagga
gaggggccgacaggtcgggggaggggctacggggaggggagcgacgccctctgctggctg
gactcggtacaggctgagtccccgcctctcatctctgtctcctccatcactgaccccgcc
tcccctggagcaccgcccctccctccccacttctgtctctcatctctgtcccctccatca
ctgaccccgcctcccctagagcgtcgctccacctggactgaccgccgccgtcgggggccc
caggaccgcacgagtagcggggacgacgcctgcagcttctccggcttccgcccagccacg
ctgactgtcaccaatttctttaagcaggaagctgagcggctcagtgacgaggacctcttc
aagtttctggctgacatgcgacgcccgtcgtctctcctgcggcgcctacggcccgtgacc
gcccagctcaagatcgacatctccccggcccccgagaacccccacttctgcctctccccg
gagctgcttcatgtgaagccctacccagaccccaggggccggcccaccaaggagatcctg
gagttcccggcccacgaggtctacgccccccacaccagctacaggaacctgctgttcgtg
tacccgcacagcctcaacttcagcagccgccagggctccgtgcgcaacctggccgtgcga
gtccagtacatggcgggcgaggaccccagccaggccctgccggtcatctttggcaagtcc
agctgcagcgagttcacccgcgaggccttcacaccggtggtctaccacaacaagtccccc
gagttctacgaggagttcaagctgcggcttccggcttgcgtgaccgacaaccaccacctg
ctgttcactttctaccacatcagctgccagccgcggccgggcacggccctggagacgccc
gtgggcttcacgtggatcccgctgctgcagcacggccgcctgaggaccggccccttctgc
ctccctgtgtccgtggaccagcccccgcccagctactccgtgctcacaccggacgtggcg
ctgccgggcatgcgctgggtggatggccacaagggcgtgttcagcgtggagctcacggcg
gtgtcgtccgtgcacccccaggacccccacctggacaagttcttcactctggtgcacgtc
ctggaggagggggccttccccttccggctcaaggacgccgtgctcagcgagggcaccgtg
gagcaggagctgcgggccagcctggcggctctgcgccttgccagccccgagcccctggtc
gccttctcccaccacgtgttggacaagctcgtgcggctcgtcgtgcgacccccgatcatc
ggtggccagatcgtaaacctaggtcgtggggcttttgaagcaatggcccatgtagtcagc
cttgtccaccggagcctggaagctgcccaggatgcccgtggtcattgcccgctgctggct
gcttatgtccactatgccttccgattgcctggcaccgagcccagcctcccgggcggggcc
cctccggtgacagtgcagtccaccacgctggcccgggggcctggccgccccgccagcctc
tacctggcccgctctaagagcatcagcagcagcaatcctgacctggccgtggcccctggc
tccgtggacgacgaggtctcccgcatcctggccagcaagggcatcgaccgctcacactcc
tgggtgaattctgcttatgctccaggaggcagcagggctgtgctgcgccgagcaccccct
tactgtggggccgaccccagacaggccatcgaccactgttctagccgaccctcctcctac
ttcgagggctcctccttggccccaccagccacccagccgagacccactgtgcagaagctg
cttcacgaggagctggctcttcagtgggtggtcagtggcagcaccgtgcgcgaggccatc
cttcaacacgcctggttcttcttccagctcatggtgaagagcatgacgctgcatctgctt
ctgggccagcggctggacacgccccgcaagctgcgcttccctgggcgcttcctggatgac
atcgcagccctggtgggctctgtgggcctggaggtcatcacccgagtccacaaggacgca
gagctggccgagcgcctcaacgccagcctggccttcttcctcagtgacctgctgtcgctg
acggaccgtggcttcgtcttcagcctggtccgggcccactacaagcaggtggccacgcgg
ctgctgtcggcccccaacccagtggcgctgctgaccctgcgcatggacttcacccgtatc
ctgtgcagccatgagcactacgtgaccctcaacctcccctgctgtcccctgtctcccccg
gcctcgccctcgccctccatatcctctaccacctcccagagctccaccttctccagccag
gccccagaccccaaggtgaccagcatgtttgagctgagcgggccgttccggcagcagcac
ttcctggctgggctcctgctcacggagctggcgctggccctggaacctgaggccgagggg
gtgtccctgctgcacaagaaggccatcagtgctgtccacagcctgctctgtggccatgac
gctgacccccgctacacggatgccactgtgaaggcccgtgtggctgagctgtacctgccc
ctgctgtcactcgcccgggacacgctgccacggctgcacgactttgctgagggtccaggt
caacggtcaagactggcctcgatgctcgactcggacacagaaggagaaggggacattgga
ggcaccatcaacccctcagtggccatggccatcgctggtggccccctggcccctggctcc
cgggccagcatctcccagggcccagcgacggcttcccgctccggctgtcccctgtctgct
gagtccagccgcaccctgctggtgtgtgtgctgtgggtcctgaagaatgccgagccagct
ctcctgcagcgctgggctgcagacctggccctgcctcagctggggcgtctcctggacttg
ctgtacctttgcctggctgccttcgagtacaaggggaaaaaggcctttgagaggatcaac
agcctcaccttcaagaagtcactggacatgaaagctcgactggaggaagccatcctgggc
accatcggagcgagacaggagatggtgcgacggagccgtgagaggagcccgtttgggaac
caggagaacgtacgctggcgcaagagcatcacgcactggaaacaaacctcagaccgcgtg
gacaagaccaaggatgaaatagaacatgaggccttggtggacgggaacctggcaactgag
gcgagcctggtggttctggatacattggagatcattgtgcagacggtgatgctgtctgag
gcccgggagagcatcttgggcgcagtactgaaggtcgtgttgtacagtctgggcagtgcc
cagagcgccctcttcttgcagcatggcctggccacacagcgggccctggtgtccaagttc
ccagagctgctgtttgaggaggacacggagctgtgtgctgacctgtgcctgaggctcctg
cgacactgcggcagccgcgtcagcgccatccggacgcacgcgagcgcctcgctctacctc
ctgatgcgccagaacttcgagatcggcaataacttcgctcgcgtgaagatgcaggtgacc
atgtcgctttcatccctggtggggacgacacagaacttcagtgaagaacacctgcgccgt
tccctcaagaccatcctcacctatgccgaggaggacgtggggctgcgcgacagcaccttc
gccgagcaggtccaggacctgatgttcaacctgcacatgatcctgacggacacggtgaag
atgaaggagcatcaggaggaccccgagatgctcatcgacctcatgtacaggattgcccgg
ggctaccagggctccccggacctgcggctgacgtggctgcagaacatggcgggcaagcac
gcggagctgggcaaccacgcggaggccgcccagtgcatggtgcatgcggccgccctggtg
gccgagtacctggccctgcttgaggacagccgccacctgcccgtgggctgcgtgtccttc
cagaacatctcgtccaacgtgctggaggagtcagccatctccgatgacatcctgtcaccc
gatgaggagggcttctgttctgggaagcacttcacggagctggggctggtggggctcctg
gagcaggcggccacctacttcaccatgggcgggctctacgaggcggtgaacgaggtctac
aagacccttatccccatcctggaagcccaccgtgactacaagaagctggccgctgtgcac
ggcaaactgcaggaggccttcaccaagatcatgcaccagccccagcgcgtcttcgggacg
tacttccgcgtgggcttctacgggtctcgcttcggcgacctggacgagcaggagttcgtg
tacaaggagccgtccatcacgaagctggccgagatctcacaccggctggaggagttctac
acggagaggttcggggaggacgtggtcgagattgtcaaagattcgaaccccgtggacaag
gccaagctcgacccccagaaggcatacatccagatcacctacgtggaaccgcactttgat
acctacgagctcaaggaccgagtgacctacttcgaccgcaactacggtctgcgcaccttc
ctcttctgcacgcccttcacgcccgacgggcgcgcgcacggcgagctcccggagcagcac
aagcgcaagacgctgctcagcacggaccacgccttcccctacatcaagacgcgcatccgt
gtgtgccaccgcgaggagacagtgctgacccccgtggaggtggccattgaggacatgcag
aagaagactcgagagctggccttcgccaccgagcaggacccgcccgacgccaagatgcta
cagatggtgctccaaggctccgtggggcccactgtgaaccagggtcccctggaggtggcc
caggtgtttttgacagagatccctgaagaccccaagctcttcaggcatcacaataaattg
cggctgtgtttcaaggacttctgcaagaagtgtgaggatgccctgcggaagaacaaggcc
ctgattgggccagaccagaaggagtaccaccgcgagctggaacgcaactacacccgcctg
cgggaggctctgcagccgctgctcacccagcgcctgccccagctgctggcacccactacg
gccagcctcaggaactccttgcacagggcaagcttccggaaggccgacgtctga

DBGET integrated database retrieval system