KEGG   Equus asinus (ass): 106846782Help
Entry
106846782         CDS       T04645                                 

Gene name
PLA2G4A
Definition
(RefSeq) phospholipase A2 group IVA
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
eai  Equus asinus (ass)
Pathway
eai00564  Glycerophospholipid metabolism
eai00565  Ether lipid metabolism
eai00590  Arachidonic acid metabolism
eai00591  Linoleic acid metabolism
eai00592  alpha-Linolenic acid metabolism
eai01100  Metabolic pathways
eai04010  MAPK signaling pathway
eai04014  Ras signaling pathway
eai04072  Phospholipase D signaling pathway
eai04217  Necroptosis
eai04270  Vascular smooth muscle contraction
eai04370  VEGF signaling pathway
eai04611  Platelet activation
eai04664  Fc epsilon RI signaling pathway
eai04666  Fc gamma R-mediated phagocytosis
eai04724  Glutamatergic synapse
eai04726  Serotonergic synapse
eai04730  Long-term depression
eai04750  Inflammatory mediator regulation of TRP channels
eai04912  GnRH signaling pathway
eai04913  Ovarian steroidogenesis
eai04921  Oxytocin signaling pathway
eai05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106846782 (PLA2G4A)
   00565 Ether lipid metabolism
    106846782 (PLA2G4A)
   00590 Arachidonic acid metabolism
    106846782 (PLA2G4A)
   00591 Linoleic acid metabolism
    106846782 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    106846782 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106846782 (PLA2G4A)
   04010 MAPK signaling pathway
    106846782 (PLA2G4A)
   04370 VEGF signaling pathway
    106846782 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    106846782 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106846782 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    106846782 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    106846782 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    106846782 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    106846782 (PLA2G4A)
   04913 Ovarian steroidogenesis
    106846782 (PLA2G4A)
   04921 Oxytocin signaling pathway
    106846782 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106846782 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    106846782 (PLA2G4A)
   04726 Serotonergic synapse
    106846782 (PLA2G4A)
   04730 Long-term depression
    106846782 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    106846782 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    106846782 (PLA2G4A)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     106846782 (PLA2G4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 106846782
NCBI-ProteinID: XP_014721269
Position
Un
AA seq 749 aa AA seqDB search
MSFIDPYQHIIVEHQYSHKFTVMVLRATKVTKGAFGDMLDTPDPYVELFISSTPDSRKRT
RHFNNNINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFPISSMKVGEKKEV
PFIFNQVTEMILEMSLEVCSSPDLRFSMALCDQEKAFRQQRKENIKENMKKLLGPKKSEG
LYSTRDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINKELMKNVSYNPLLLLTPQKIKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQNKGSTMEEE
LENITAKHIVSNDSSDSDDESQEPKGTENEDAERDYQNDNQASWVHRMLMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLRDFTTQESLDEDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDVEKDCPTIIHFVLANINFRKYKAPGVPRETK
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKNAIVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLNKPTA
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttatagatccttatcagcacattatagtggagcaccagtattcccacaagttc
acggtaatggtgttacgtgccaccaaagtgacaaagggggccttcggtgacatgcttgac
actccagatccctacgtggaacttttcatctcctcaacccctgacagcaggaagagaaca
agacacttcaataacaacataaaccccgtgtggaatgagacctttgaatttattttggat
ccgaatcaggaaaatgttttggagattacgttaatggatgccaattatgtcatggatgaa
actctggggacagcaacatttcccatatcgtctatgaaagtgggagagaagaaagaggtt
cctttcattttcaaccaagtcactgaaatgattctggaaatgtctcttgaagtttgttcg
tccccagacctccgatttagcatggctctgtgtgatcaggagaaagctttcagacaacag
agaaaagagaacataaaggaaaacatgaagaaactcctgggtccaaagaagagtgaaggc
ttgtattcaacacgtgatgtgcctgtggttgccatcttgggctcaggcggagggttccga
gccatggtgggattctccggggtgatgaaggcactgtatgagtcaggaatcttggattgt
gctacctatgtggctggtctttctggctccacgtggtacatgtcaactttgtattctcac
cctgattttccagagaaagggccagaggagattaataaagagctaatgaaaaatgttagc
tacaacccccttttacttctcacgccacagaaaattaagagatatgttgagtctttgtgg
aagaagaaaagctctggacaacctgtcacctttactgatatctttgggatgttaatagga
gaaacactaattcacaatagaatgaacactaccttgagtagtttgaaggaaaaggtcaat
actgcacagtgcccgttacctcttttcacctgtctccatgtgaaacccgatgtttcagag
ctgatgtttgcagattgggttgaatttagtccgtatgagattggcatggctaaatatggg
acttttatggctccagacttatttggaagcaaattttttatgggaacagttgtgaagaaa
tatgaagaaaaccctttgcatttcttaatgggtgtctggggcagtgccttttctatattg
ttcaacagagtcttgggagtttctggctcacaaaataaaggttccacaatggaggaagaa
ttagaaaatattacggcgaagcatattgtgagtaatgatagctcagatagcgatgatgaa
tcacaagaacccaaaggcactgagaatgaagatgctgaaagggactatcaaaatgataat
caagcaagttgggtccatcgcatgttaatggccttggtgagtgactccgctttattcaat
accagagaaggacgtgctgggaaggtgcacaacttcatgctgggcttgaatctcaacaca
tcctacccactgtctcccttgagggactttaccacacaggaatccttggatgaagatgaa
ctggatgcagctgtagcagatcctgatgagtttgagcgcatatatgagcctctggatgtc
aaaagtaaaaagattcatgtagtggatagtggcctcacatttaacctgccgtacccgctg
atcctgagacctcaaagaggagttgatctcatcatctcctttgacttttctgcaaggcca
agcgactctagtcctccattcaaggaacttctacttgcagaaaagtgggctaaaatgaac
aagctcccttttccaaagattgatccttatgtgtttgatagagaaggactgaaggagtgc
tatgtctttaaacccaagaatcccgatgtggagaaagattgcccaaccatcatccacttt
gttctggccaacatcaacttcaggaagtacaaggctccaggtgttccaagagaaactaag
gaagagaaagaaatagctgattttgatatttttgatgacccagaatcaccattttcaacc
ttcaactttcaatatccaaatcaagcattcaaaaggctgcacgatctgatgcacttcaat
accctgaacaacattgatgtgattaagaatgccatcgttgaaagcattgaatatagaagg
cagaatccgtctcgttgctctgtttccctcagtaatgttgaggcaagaagattcttcaac
aaggagtttctaaacaaacccacagcatag

DBGET integrated database retrieval system