KEGG   Equus asinus (ass): 106846819Help
Entry
106846819         CDS       T04645                                 

Gene name
KCNK2
Definition
(RefSeq) potassium two pore domain channel subfamily K member 2
  KO
K04913  potassium channel subfamily K member 2
Organism
eai  Equus asinus (ass)
Pathway
eai04927  Cortisol synthesis and secretion
eai04934  Cushing syndrome
eai04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:eai00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    106846819 (KCNK2)
  09154 Digestive system
   04971 Gastric acid secretion
    106846819 (KCNK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106846819 (KCNK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:eai04040]
    106846819 (KCNK2)
Ion channels [BR:eai04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   106846819 (KCNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 106846819
NCBI-ProteinID: XP_014721333
Position
Un
AA seq 509 aa AA seqDB search
MGLGHLGGVSEGGGGSTLGSSRQAGRMVTLVTLVAHCLVGQAVVLKKAGFSCGSSGLGSR
ASTRRGSRIQSTFADLVKKPNHYPSNLLHPNLHSLLLSVAAPDLLDPKSAAQNSKPRLSF
STKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVI
QKQTFISQHSCVNSTELDELIQQIVAAVNAGIIPLGNTSNQISHWDLGSSFFFAGTVITT
IGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVS
QTKIRIISTIIFILFGCVLFVALPAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGS
DIEYLDFYKPVVWFWILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVT
AEFKETRRRLSVEIYDKFQRATSIKRKLSAELAGNHNQELTPCRRTLSVNHLASERDVLP
PLLKTESIYLNGLTPHCAGEEIAVIENIK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgggacaccttgggggagtttccgaaggaggaggagggtcaacccttgggagt
agccgacaggcaggacgcatggtgaccctggtcacacttgttgcccactgcctggtggga
caggcagtggtgctgaaaaaagctggtttctcctgtgggagttctggtttaggttccaga
gcttccaccaggagaggaagcagaattcagtcaacctttgccgacctcgtaaagaagcct
aaccattacccctctaatctcctccatcctaaccttcattctctgttgttgtcagtggcg
gcacctgatttgctggatcctaaatctgccgctcagaactccaaaccgaggctctccttt
tccacgaaacccacagtgcttgcctcccgggtggagagtgacacgaccattaatgttatg
aaatggaagacggtctccacgattttcctggtggttgtcctctatctgatcatcggagcc
accgtgttcaaagcgttggagcagcctcacgagatttcacagaggaccaccatcgtgatc
cagaaacaaacattcatttcccaacactcctgtgtcaattcgactgagctggacgaactc
atccagcaaatagtggcagcagtaaatgcgggaattatccctttaggaaacacctccaat
caaatcagtcactgggatttgggaagttccttcttctttgctggcactgttattacaacc
ataggatttggaaacatctcaccgcgcacagaagggggaaaaatattctgtatcatctat
gccttactgggaattcccctctttggttttttgttggctggagttggagatcaattaggg
accatatttggaaaaggaattgcaaaagtggaagatacgtttattaagtggaatgttagt
cagaccaagattcgcatcatctcaacaatcatatttatcctgtttggctgtgtactcttc
gttgctctgcctgcaatcatattcaagcacatagaaggctggagtgccctggacgccatt
tattttgtggttatcactttaaccaccattggatttggtgactacgttgcaggtggatca
gatattgaatatctagacttctataagcctgtcgtgtggttttggatccttgtagggctg
gcttactttgctgctgtcctgagcatgattggagactggctccgagtgatatcaaaaaag
acaaaggaagaggtgggagagttcagagcccatgctgctgagtggacagccaacgtcaca
gccgaattcaaggaaaccaggaggcggctgagtgtggaaatttatgacaagttccagcgc
gccacctccatcaagcggaagctctccgcagaattggccgggaaccacaaccaggagctc
actccttgtaggaggaccctgtcagtgaaccacctagccagcgagagggatgtcttgcct
cccttactgaaaactgaaagtatctatttgaacggattgacaccacactgtgcaggcgag
gaaattgctgttattgagaacattaaatag

DBGET integrated database retrieval system