KEGG   Equus asinus (ass): 106846979Help
Entry
106846979         CDS       T04645                                 

Gene name
GBA2
Definition
(RefSeq) glucosylceramidase beta 2
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
eai  Equus asinus (ass)
Pathway
eai00511  Other glycan degradation
eai00600  Sphingolipid metabolism
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106846979 (GBA2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    106846979 (GBA2)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     106846979 (GBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H GDE_C DUF5127
Motif
Other DBs
NCBI-GeneID: 106846979
NCBI-ProteinID: XP_014721537
Position
Un
AA seq 914 aa AA seqDB search
MGTGVLASEQTGCAKGHPQDTEGTEGMQVTDCESPEDSRPQNEPGYCDPEDSGQLMASYE
GKAKGYQVPPFGWRICLAHEFAEKRKPFHANNISLSNLIKHLGMGMRYLQWWYQKTQVEK
KTPFIDFMNCVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHRTVIADQFTVC
LRREGQTVYQQVLSVERPRVLRSWNWGLCGYFAFYHALYPRAWTVYQLPGQNVTLTCRQI
TPILPHDYQDSSLPVGVFVWDVENEGDEALDVSIMFSMRNGLGGGDDAPGGLWNEPFCLE
QDGETTQGLLLHHPTLPNPYTMAVAARLTADTTVTHITAFDPDSTGQQVWQDLLQDGQLD
SPAGPSTPTQKGVGIAGAVCVAGKLSPRGRCRLEFSLAWDMPRIMFGAKGQDYYRRYTRF
FGPDGDAAPALSHYALCRYADWEERISAWQSPILDDRSLPAWYKSALFNELYFLADGGTV
WLEVPEDSLPEELAGSMCQLRPILQEYGRFGYLEGQEYRMYNTYDVHFYASFALIMLWPK
LELSLQYDMALATLGEDLTRRRYLMSGVMAPVKKRNVIPHDIGDPDDEPWLRVNAYLIHD
TADWKDLNLKFVLQIYRDYYLTGDQGFLRDMWPVCLAVMESEMKFDKDQDGLIENGGYAD
QTYDGWVTTGPSAYCGGLWLAAVAVMVQMAALCGAQDVQDRFSSILSRGQEAYERLLWNG
RYYNYDCSSQPQSRSIMSDQCAGQWFLRACGLGEGDTEVFPTRHIVRALQTIFELNVQAF
AGGAMGAVNGMQPHGVPDRTSVQSDEVWVGVVYGLAATMIQEGLTWEGFRTAEGCYRTVW
ERLGLAFQTPEAYCQQQVFRSLAYMRPLSIWAMQLALQQQQHKKASRPTAKQGTGLSTGP
TCGPKEAMANLSLE
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccggagtcctagcctcggagcagaccggctgtgccaaagggcatccacaagat
actgaaggcactgagggtatgcaggttacagactgcgagagccctgaggacagtcgaccc
caaaatgagcctggctactgcgatccagaggactctgggcagctgatggcttcctatgag
ggtaaagctaagggctaccaggtgcctccctttggctggcgcatctgcctggctcatgag
tttgcagagaagcggaaaccctttcatgccaacaacatctccctaagcaacctgataaag
catctgggcatgggcatgaggtacttgcagtggtggtaccagaagacccaggtagagaag
aagacacctttcatcgacttcatgaattgtgtacccctgagacagatctacggttgtccc
ttgggtggtatcgggggaggcactatcacacgtggctggagaggccagttctgtcgttgg
caacttaatcctggaatgtaccagcaccggacagtcatcgctgaccaattcacagtgtgc
ttgcgtcgggaagggcagactgtataccagcaagtcctatccgtggagcgcccaagggtc
ctgcgcagctggaactggggcctgtgtgggtactttgcattctaccatgccctctatccc
cgagcttggactgtctatcagcttcctggccagaatgtcacccttacctgccgccagatc
acacccatcttgccccatgactaccaggacagcagcctgcctgttggagtctttgtgtgg
gacgtggagaatgaaggagatgaagccctagatgtttccatcatgttctccatgcggaat
ggcctggggggtggagatgatgccccagggggtttgtggaacgagcccttctgtctggag
caggatggggagaccacacaggggctgctgctgcaccatccaaccctcccaaatccctac
acgatggctgtggctgcacgacttacggcagataccacggtaacccacatcacagccttt
gaccctgacagcactgggcagcaggtgtggcaggatctacttcaggatggacagctggac
tcccccgctggcccaagcactcctacgcagaaaggggtaggcattgctggggctgtgtgt
gttgctggcaagctgtcacctcgaggccggtgccgcctggagttctcactggcttgggac
atgcccagaatcatgtttggagctaagggccaggactactacaggaggtacacaaggttc
tttggccctgatggtgatgcagcacccgcccttagtcactatgcactgtgccggtatgca
gactgggaagagaggatctcggcttggcaaagccctatattggacgacagatccttgcct
gcctggtacaaatctgcactgttcaatgaactatatttcctggccgatggaggcacagta
tggctggaagttcctgaggactccctaccagaggagctggcggggagcatgtgtcagctc
cgccccatcctacaagagtatggccgatttggctaccttgaaggccaagaatatcgcatg
tacaacacatatgatgtccacttttacgcttccttcgccctcatcatgctctggcccaaa
ctagagctcagcctgcagtatgacatggctctggccactcttggggaggacctgacaagg
cgacggtacctgatgagtggggtgatggcacctgtgaaaaagcggaatgtcatcccccat
gatattggggacccagatgatgagccatggctccgggtcaatgcgtatttgatccatgac
actgctgactggaaggacctgaacctgaagtttgtgctacagatttatcgggactattac
ctgacgggtgaccagggcttcctgagagacatgtggcctgtgtgtctggctgtgatggag
tctgaaatgaagtttgacaaggaccaagatggactcattgagaatggaggctacgcagat
cagacctatgatggatgggtcaccacaggccccagtgcttactgtggaggactgtggctg
gcagctgtggctgtgatggtccagatggctgctctgtgtggggcacaggacgtccaggac
aggttttcttccatcctcagccggggccaagaagcatatgagagactgctgtggaatggc
cgctattacaactatgattgcagctctcagcctcagtctcgtagcatcatgtctgaccag
tgtgctggccagtggttcctgagggcctgtggcctcggagaaggagacactgaggtattt
cctacccgacacatagtccgtgctctccagactatctttgagctcaatgtccaggccttt
gcaggaggggccatgggggctgtgaatgggatgcagccccatggtgtccctgatagaacc
agtgtccagtctgatgaagtctgggtgggtgtggtctacgggctggcagccaccatgatc
caggagggcctgacttgggagggcttccggacagcagaaggctgctaccgtaccgtgtgg
gagcgcctgggcctggccttccagactcctgaggcctactgccagcagcaggtgttccgc
tcgctggcctacatgcggccactgagcatctgggctatgcagctggccctgcagcagcag
cagcataaaaaagcctccaggccaacagccaaacagggcacaggactaagcacagggcct
acatgtggaccaaaggaagccatggcaaacctgagcctagagtga

DBGET integrated database retrieval system