KEGG   Equus asinus (ass): 106847095
Entry
106847095         CDS       T04645                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
eai  Equus asinus (ass)
Pathway
eai04080  Neuroactive ligand-receptor interaction
eai04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106847095 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106847095 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 106847095
NCBI-ProteinID: XP_014721718
Position
Un
AA seq 63 aa
MTGFLLPAGPLLQPPDGQGLEEGDVRYLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGP
MPF
NT seq 192 nt   +upstreamnt  +downstreamnt
atgacaggctttctccttcctgcagggcccctgctgcagcctcctgacgggcaggggctg
gaggaaggcgatgtccgctacctggtgcagcccagagggtcgagaaacggaccagggccc
tggcagggagggcggaggaaattccgccgccagcggccgcgcctctcccataagggcccc
atgcctttctga

DBGET integrated database retrieval system