KEGG   Equus asinus (ass): 106847915Help
Entry
106847915         CDS       T04645                                 

Gene name
ST3GAL3
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 3
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
eai  Equus asinus (ass)
Pathway
eai00514  Other types of O-glycan biosynthesis
eai00515  Mannose type O-glycan biosynthesis
eai00533  Glycosaminoglycan biosynthesis - keratan sulfate
eai00601  Glycosphingolipid biosynthesis - lacto and neolacto series
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    106847915 (ST3GAL3)
   00514 Other types of O-glycan biosynthesis
    106847915 (ST3GAL3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    106847915 (ST3GAL3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    106847915 (ST3GAL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:eai01003]
    106847915 (ST3GAL3)
Enzymes [BR:eai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     106847915 (ST3GAL3)
Glycosyltransferases [BR:eai01003]
 Terminal extension
  Sialyltransferase
   106847915 (ST3GAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 106847915
NCBI-ProteinID: XP_014722980
Position
Un
AA seq 379 aa AA seqDB search
MGLLVFVRNLLLALCLFLVLGFLYYSVWKLHLLQWEDSKYDRLGFLLKLDSKLHYHLCLT
LPINQLSSQGNELRPPELATKYANFSEGTCKPGHASALMTAIFPRFSKPAPMFLDDSFRM
WARIQEFVPPFGIKGQDKLIRAILSVTKEYHLTPALDSLSCRRCIIVGNGGVLANKSLGS
RIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQQPEQYERDSLFVLAGFKWQDF
RWLKYIVYKERMSALDGFWKSVATRVPKEPPEIRILNPYFIQEAAFNLIGLPFNNGLMGR
GNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREK
DFLRKLVKAHVITDLTSGI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgggactcttggtatttgtgcgcaatctgctgctagccctctgcctttttctagtactg
ggatttttgtattattctgtgtggaagctgcatttactccagtgggaggactccaagtat
gatcgattgggcttcctcttgaagctggactctaaactccattaccacctctgcctgaca
cttcctattaatcaactgtcaagtcaaggcaacgaattgaggccacctgagttagccacc
aagtacgcaaacttttcagagggaacttgcaagcctggacatgcttcagccttgatgact
gccatcttcccccggttctccaagccagcacccatgttcctggatgactccttccgcatg
tgggctaggatccaggaatttgtgccgccttttgggatcaaaggtcaagacaagctgatc
agagccatcttgtcagtcaccaaagagtaccacctgacccctgccttggacagcctcagt
tgccgccgctgcatcatcgtgggaaatggaggtgtccttgccaacaagtctctggggtca
cgaattgatgactatgacattgtggtcagactgaactcagcaccagtgaaaggctttgag
aaggacgtgggcagcaaaacgaccctgcgcatcacctaccctgagggcgccatgcagcag
cccgagcagtacgaacgggattctctctttgtcctcgctggcttcaagtggcaggacttc
aggtggttgaagtacatcgtctacaaggagagaatgagtgcattggatggcttctggaaa
tctgtggccactcgagtgcccaaggagccgcctgagattcgcattctcaacccatatttc
atccaggaggctgccttcaacctcatcggactgcccttcaacaatggcctcatgggccgg
gggaacatcccgacccttggcagtgtggcagtgaccatggcactacacggctgtgatgag
gtggcagttgcaggttttggctacgacatgagcacgcccaacgcacccctgcactactat
gagactgtgcgcatggccgccatcaaagagtcctggacacacaatattcagcgagaaaaa
gactttctgcggaagctggtgaaagcgcatgtcatcactgacttaaccagtggcatctga

DBGET integrated database retrieval system