KEGG   Equus asinus (ass): 106848559Help
Entry
106848559         CDS       T04645                                 

Gene name
LTB4R
Definition
(RefSeq) leukotriene B4 receptor
  KO
K04296  leukotriene B4 receptor 1
Organism
eai  Equus asinus (ass)
Pathway
eai04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106848559 (LTB4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:eai04030]
    106848559 (LTB4R)
G protein-coupled receptors [BR:eai04030]
 Rhodopsin family
  Lipid
   Leukotriene
    106848559 (LTB4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 106848559
NCBI-ProteinID: XP_014724024
Position
Un
AA seq 416 aa AA seqDB search
QHPGPGPGPWHWDRSGDRLHHSALTLGLAPASNQYPEEPVFAMATNITSPVTPSSVSGMV
IPLLAIILLSVALAVGLPGNGFVVWSILVKMRKRSVTALLVLNLAVADLAVVLTAPFFLH
FLARGTWIFGSAACCLFHYVCGVSMYASVLLITAMSLDRSLAVALPFVSQKIRTKRIAWR
LLAGLWVVSFLLATPVIVYRKVTSGRNNRTLICFPVYPSEGHRAFHLLFEAITGFLLPFL
VVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLADAGRALAGKASG
SGLVGHRLFLARQVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKMLEGTGSEMSST
RRGGTLNLTVKGAPTSPEPAPSESLTLSTNPLEXRGELMLGVERKKGGREGRVRAE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
cagcacccaggcccagggccaggcccctggcactgggacagatctggggataggctacac
cactctgccctgaccctgggattggcaccagcttccaaccagtacccggaagagcctgtc
tttgcaatggccacaaacattacatctcctgtaacaccctcctcagtaagtggcatggtc
atccctctgctggctatcatcctactgtcagtggcgctggctgtgggccttcctggcaac
ggctttgtggtgtggagcatcctggtaaagatgcggaagcgctctgtcactgccctgctg
gtgctgaacttagctgtggctgacttggctgtagtgctcactgccccctttttcctccac
ttcctggcccgaggcacctggatttttggatcagctgcctgctgcctgttccactatgtc
tgtggagtcagcatgtatgccagtgtcctgcttattacggccatgagtctggaccgctcg
ctggcagtggccctcccctttgtgtcccagaagatccgcaccaagaggattgcctggcgg
ctgctggcaggcctctgggtggtgtcctttctgctggccacgcccgtcatcgtataccgc
aaagtaacctcgggacgcaacaacaggaccctgatctgcttcccagtgtaccccagtgag
ggacacagggccttccacctgctcttcgaggccatcactggcttcctgctgcccttcctg
gtcgtggtggccagctactccgacatcgggcgcaggctgcaggccaggcgctttcgccgc
agccgccgcacgggtcgcctggtggtgctcatcatcttgaccttcgctgccttctggctg
ccctaccacgtggtgaacctggccgatgcgggccgcgcgctggctggcaaggcctctggg
tccgggctggtggggcaccggctgttcctggcccgccaggtgctcatcgcgctggccttc
ctgagcagcagcgtgaaccccgtgctgtacgcgtgcgccggcggcggcctgctgcgctca
gcgggcgtgggcttcgttgccaagatgctggagggcaccggctccgagatgtccagcacg
cgccgtgggggcaccctgaacctgactgtaaagggcgcccccacctcccccgagcctgca
ccctccgagagcctcactctctccaccaaccctctcgaatgaagaggagaactcatgttg
ggggtggagcggaagaagggggggcgggagggccgagtaagggcggagtga

DBGET integrated database retrieval system