KEGG   Ensifer alkalisoli: EKH55_0138Help
Entry
EKH55_0138        CDS       T06241                                 

Definition
(GenBank) Enoyl-CoA hydratase [isoleucine degradation]
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
eak  Ensifer alkalisoli
Pathway
eak00071  Fatty acid degradation
eak00280  Valine, leucine and isoleucine degradation
eak00281  Geraniol degradation
eak00310  Lysine degradation
eak00362  Benzoate degradation
eak00380  Tryptophan metabolism
eak00410  beta-Alanine metabolism
eak00640  Propanoate metabolism
eak00650  Butanoate metabolism
eak00903  Limonene and pinene degradation
eak00930  Caprolactam degradation
eak01100  Metabolic pathways
eak01110  Biosynthesis of secondary metabolites
eak01120  Microbial metabolism in diverse environments
eak01200  Carbon metabolism
eak01212  Fatty acid metabolism
Module
eak_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EKH55_0138
   00650 Butanoate metabolism
    EKH55_0138
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EKH55_0138
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EKH55_0138
   00310 Lysine degradation
    EKH55_0138
   00380 Tryptophan metabolism
    EKH55_0138
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EKH55_0138
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EKH55_0138
   00281 Geraniol degradation
    EKH55_0138
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EKH55_0138
   00930 Caprolactam degradation
    EKH55_0138
Enzymes [BR:eak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EKH55_0138
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EKH55_0138
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EKH55_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 UDPG_MGDP_dh_N NAD_binding_8 FAD_binding_3 NAD_binding_7 2-Hacid_dh_C Pyr_redox_2 Pyr_redox ApbA NAD_Gly3P_dh_N F420_oxidored GIDA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: QFI65012
Position
1:complement(139857..142070)
Genome map
AA seq 737 aa AA seqDB search
MSYTNFKIETDADGIVLVTWDMPEKTMNVFTQEVMAELDAIVDQTSGDPAVKGVVITSGK
SSFSGGADLTMIKSMFAIQAEEKAKDPANASQKLFDLAGRLSGLFRKLETSGKPWVSAIN
GTCMGGAFELSLACHGRVASNAKSVKIALPEVKVGIFPGAGGTQRVPRLTNTQDALQMMT
TGSSLTAARAKAMGLVHEVVDPDKLIDAAKGMIKNGLKPVQPWDEKGFKLPGGGIWTPAS
AQLWPAASAILRRETYGNYPGAIAILKSVYEGLQVPFDTGLRIEQRYFTEILQTTEAFSM
IRSLFISMQELGKGARRPAGVPKTELKKVGVIGAGFMGASIAYVTAAAGIPVTLIDRDME
AAGKGKAHSEGLVKDSIGKGRLTKGEGEALLSRITPSADYGDLKDADLVIEAVFEDRQVK
KDVIENVEAVIAQDAIFASNTSTLPITGLAKNSKRPDQFIGIHFFSPVEKMMLTEVILGK
ETGDRALATALDYVAAIKKTPIVVNDTRGFYVNRCVFRYIHEAYDMLIEGVPPAMIENAA
KMAGMPVGPLSLNDEVAIDLSQKILKATVADLGEKAVDPRHMALIDKMVDEFDRRGRKNG
KGFYEYPAKPAKKYLWPGLKELYPQKDAEKIDVEVLKRRFLATIALEAARTIEEGIVTDP
READVGSILGFGFAPYTGGTLSYIDGMGVNAFVELCEKLAEDYGDHFKPTPLLKDMAEKG
ETFYGRFNPYGEAQRAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatacgaacttcaagatcgaaaccgacgccgacggcatcgtgctggtcacctgg
gacatgcccgagaagacgatgaacgtcttcactcaggaggtgatggcggagctcgacgcc
attgtcgatcagacgagtggtgatccggccgtcaagggcgtcgtcatcacctccggcaaa
tcctccttctccggcggtgccgacctcacgatgatcaagtcgatgttcgcgatccaggcc
gaagaaaaggcgaaggatccggccaatgcgtcgcaaaagctcttcgatctcgctggccgg
ctgagcggcctcttccgcaagcttgaaacctccggcaagccctgggtctccgcgattaac
ggcacctgcatgggcggcgctttcgagctgtcgctcgcctgccatgggcgtgtcgcctcc
aatgcgaaatctgtgaagatcgcgctgcctgaggtcaaggtcggcatttttcccggtgcc
ggcggcactcagcgcgtgccgcgcctgaccaatacgcaggacgcgctgcagatgatgacg
accggctcgtcgctgacggccgcccgcgcgaaggccatgggtctcgtgcacgaagtggtc
gatccagacaagttgatcgacgccgccaaggggatgatcaagaacggcctgaagccggtt
cagccctgggacgaaaagggattcaagctgcccggcggcggcatctggacgccggcttcc
gcgcagctctggcccgcggcctcggccatcctgcgccgcgagacctatggcaattatccg
ggggccatcgccatcctgaaaagcgtctacgagggactgcaggttcccttcgatacgggc
ctcaggatcgagcagcgctatttcactgaaatcctgcagacgaccgaagctttttcgatg
atccgttcgctgttcatctcgatgcaggagctcggcaagggcgcccgccggccggccggc
gtgccgaagaccgagttgaaaaaggtcggcgtcatcggcgcaggcttcatgggcgcctcg
atcgcttacgtaacggccgccgccgggattcccgtcacccttatcgaccgcgacatggaa
gcggccggaaagggcaaagcgcattcggaggggctggtcaaggactcgatcggcaaaggc
cggctaacgaagggcgagggcgaggccctgctttcgcgcatcacgccgtcggccgattat
ggcgatctcaaggacgcagacctcgtgatcgaggcggtcttcgaagaccggcaggtgaag
aaagacgtaatcgagaatgtggaagcggtaatcgcccaggatgcgatcttcgcctcgaac
acctcgacgctgccgatcaccggcctcgccaagaactccaaaaggccggaccagttcatc
ggtatccatttcttctcgccagtcgagaagatgatgctgacggaagtgatcctcgggaag
gagaccggcgaccgagcgctcgcgacggcgctcgattacgtcgcagcgatcaagaagaca
ccgatcgtcgtcaacgacacgcgcggcttctacgtcaaccgctgcgtcttccgctatatc
cacgaggcctatgacatgctgatagagggcgtgccgccggcgatgatcgagaacgccgcc
aagatggccggcatgccggtcgggccgctgtcgctcaacgacgaggtggcgatcgacctc
agccaaaagatcctgaaagcgaccgttgccgatctcggcgagaaagccgtcgatccgcgc
cacatggcgttgatcgacaagatggtcgacgagttcgaccgccgcggacgcaagaacggc
aagggcttctacgaatatccggcaaagccggcgaagaagtatctctggccgggtcttaag
gagctctatccgcagaaggacgccgagaagatcgatgtcgaggtgctgaagcggcgcttc
ctcgcgaccatcgcgctggaagccgcccgcacgattgaggaaggcatcgtcaccgacccg
cgtgaggccgatgtcggttctatcctaggcttcggttttgcgccgtataccggcggtacg
ctctcctatatcgacggcatgggcgtcaatgccttcgtcgaactctgcgaaaagctcgcc
gaagactacggcgaccacttcaagccgacgccgcttctgaaagacatggccgagaaaggc
gagaccttttatggccgcttcaacccctatggcgaggcgcagcgggcggcatag

DBGET integrated database retrieval system