KEGG   Escherichia albertii: EAKF1_ch0822Help
Entry
EAKF1_ch0822      CDS       T03986                                 

Gene name
cobC
Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
eal  Escherichia albertii
Pathway
eal00860  Porphyrin and chlorophyll metabolism
eal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EAKF1_ch0822 (cobC)
Enzymes [BR:eal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     EAKF1_ch0822 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AHE58728
UniProt: W0AN16
Position
868085..868696
Genome map
AA seq 203 aa AA seqDB search
MRLWLIRHGETQANVDGLYSGHAPTPLTARGIEQAKNLHTLLRNVPFDTVLCSELERAQH
TARLVLDSRQLCVQTIPELNEMFFGDWEMRHHRELMQEDSENYNAWCNDWLHAAPTNGES
FQTFAQRVERFITALSEYQQYRNILIVSHQGVLSLLIARLLDMSAEAMWHFRVDQGCWSA
IDINDAFATLRVLNNRAIWRADE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgtggttaattcgtcacggcgaaacgcaagcgaatgtcgatggtctgtacagt
ggtcatgcaccaacaccactgacggcacgcggtattgagcaagcgaaaaacctgcatact
ctactgcgaaatgttccctttgataccgttttgtgcagtgaactggagcgcgcgcaacat
accgcgcggctggttcttgattcccgtcagctctgcgtacaaaccattcctgaactcaac
gaaatgttttttggcgactgggaaatgcggcaccatcgcgagctcatgcaagaagattcc
gaaaattataacgcctggtgcaatgactggctgcatgcggccccaactaacggtgaaagt
tttcagacgtttgcgcaacgagtggaacgttttatcaccgcgcttagtgaatatcagcaa
taccggaatatattgatcgtcagtcatcagggagtgctgagtctgttaattgcccgttta
ctggacatgtcagccgaggcgatgtggcattttcgtgtcgaccagggatgttggagcgcc
attgatatcaatgatgcattcgctactctacgcgtcctcaataaccgagccatctggcgc
gccgatgaatga

DBGET integrated database retrieval system