KEGG   Escherichia albertii: EAKF1_ch1598cHelp
Entry
EAKF1_ch1598c     CDS       T03986                                 

Definition
(GenBank) ribose import ATP-binding protein RbsA
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
eal  Escherichia albertii
Pathway
eal02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eal00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EAKF1_ch1598c
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eal02000]
    EAKF1_ch1598c
Enzymes [BR:eal01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     EAKF1_ch1598c
Transporters [BR:eal02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    EAKF1_ch1598c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N AAA_16 AAA_23 AAA_30 RsgA_GTPase ABC_ATPase AAA_22 MMR_HSR1 DUF2813 TsaE AAA_15 DUF815 DLIC AAA_27
Motif
Other DBs
NCBI-ProteinID: AHE59485
UniProt: W0AT63
Position
complement(1695345..1696847)
Genome map
AA seq 500 aa AA seqDB search
MTTGQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYH
ADRGTIWLDGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKRFGLLRRK
EMEKRATELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQE
VELLFGLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETRELPQIELVKM
MLGRELDTHALQRAGRTLLSDKPVAAFKNYGKKGTIAAFNLEVRPGEIVGLAGLLGSGRT
ETAEVIFGIKPADSGTALIKGKLQPLRSPHQASVLGIGFCPEDRKTDGIIAAASVRENII
LALQAQRGWLRPIPRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRWLLTR
PQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRKQ
VAEIPLAELSVPAIMNAIAA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgggcaacaccaggaaatcctccgcaccgaaggattaagcaaatttttcccc
ggcgttaaagcgttagacaatgttgatttcagcctgcgccgtggcgaaatcatggcgctg
ctcggtgaaaacggggcaggaaaatcgacgttaatcaaagcattaactggcgtttaccat
gccgatcgcggcaccatctggctggacggtcaggctatctcaccgaaaaacaccgcccac
gcgcagcagcttggtataggcactgtctatcaggaagttaacttgctgcccaacatgtcg
gtcgccgacaatctattcataggtcgcgagcctaaacgtttcggcctgctacggcgtaaa
gagatggaaaagcgcgccaccgaactgatggcatcctacggtttttccctcgacgtgcgt
gaacctctcaaccgtttttcggtagcgatgcagcaaatcgtcgctatttgccgggcgatt
gatctctctgccaaagtgctgatcctcgatgaacccactgccagcctcgacactcaggaa
gtggaactcctgtttggcctgatgcgtcagcttcgcgatcgcggtgttagcctgatcttc
gtcactcattttctcgatcaggtgtatcaggtcagcgatcggatcaccgtattacgcaac
ggcagtttcgtaggctgtcgggaaacccgcgagctaccgcagattgaactggtgaaaatg
atgctggggcgcgaactggatacccacgcgctacagcgtgccgggcgaacattgctgagc
gacaaacccgttgccgcgtttaaaaattatggcaaaaaagggaccattgcggcgtttaat
ctcgaagtgcgacctggcgagatcgtcggcctggcaggcctgctgggatccgggcgcacc
gaaaccgctgaagttatctttggcatcaaacccgccgatagcggcacggcgctgatcaaa
ggcaaactacaacccctgcgatcgccacatcaggcttcggtactgggcattggcttctgc
ccggaagacaggaaaaccgatggcatcatcgccgccgcctcggtgcgggaaaatatcatc
ctggcgctgcaggcccagcgcggttggttacgaccgattcctcgcaaagaacaacaagaa
attgccgaacgctttatccgccagcttggcattcgcacaccttccactgaacagccgata
gagtttctctctggtggcaatcagcaaaaagtattgctctcacgctggctactgactcgg
ccgcaatttctgatcctcgatgagccaactcgcggcattgatgttggtgcccacgccgag
atcattcgcctgattgaaacgctgtgcgccgatggcctggcgctgctggtgatctcctcc
gaactggaggagttggtgggttatgccgaccgggtgatcatcatgcgcgatcgcaaacag
gtggcggagatcccgctggcagagctttccgttccggcgatcatgaacgccattgcggcg
taa

DBGET integrated database retrieval system