KEGG   Escherichia albertii: EAKF1_ch1838cHelp
Entry
EAKF1_ch1838c     CDS       T03986                                 

Definition
(GenBank) succinyl-CoA synthetase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
eal  Escherichia albertii
Pathway
eal00020  Citrate cycle (TCA cycle)
eal00640  Propanoate metabolism
eal00660  C5-Branched dibasic acid metabolism
eal01100  Metabolic pathways
eal01110  Biosynthesis of secondary metabolites
eal01120  Microbial metabolism in diverse environments
eal01130  Biosynthesis of antibiotics
eal01200  Carbon metabolism
Module
eal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAKF1_ch1838c
   00640 Propanoate metabolism
    EAKF1_ch1838c
   00660 C5-Branched dibasic acid metabolism
    EAKF1_ch1838c
Enzymes [BR:eal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     EAKF1_ch1838c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AHE59718
UniProt: W0AQI3
Position
complement(1933907..1934779)
Genome map
AA seq 290 aa AA seqDB search
MSVLINKHTRVLVQGITGKNGTFHTEQAIAYGTQIVGGVTPGKGGQRHLDRPVFDSMKEA
MRQTEADASVIYVPAPFVLDSVVEAIESGVKLIVVITEGVPTLDMVRVRRLLDCHPDVRL
IGPNCPGIITPGECKIGIMPGEIHRPGRIGIVSRSGTLTYEAVAQTTALGLGQSTCIGIG
GDPVPGTNFIDALRLFENDPQTNAVIMIGEIGGNAEERAAEFIRHEMIKPVVGYIAGVTA
PKGKRMGHAGAIISGGSGSAEDKFRAFDKAGMAWTRNPALLGDTLWNVIK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttttgatcaacaaacacacgcgggtactggtgcagggcattaccgggaaaaac
ggcacatttcatacagagcaggctattgcgtatggcacgcagattgtggggggagtgacg
ccaggtaagggcgggcaacggcatctggatcgcccggtttttgattcaatgaaagaagcg
atgcgacaaacagaggccgatgccagcgtgatttatgtgcctgcgccgtttgtgctggat
tctgtcgttgaggctattgagtctggcgtcaaattgattgtggtgattaccgaaggtgtg
ccgacactggatatggtgagagtacgtcgactgcttgattgccacccggatgtgcggctg
attggaccaaactgcccgggaatcatcacaccgggtgagtgtaaaatcggcattatgccc
ggtgaaatccaccgacctgggcgtatcgggattgtttcccgctccggtacattaacctac
gaagccgtagcgcaaactaccgcgctggggcttgggcaatccacctgtattggtattggc
ggcgatccggttccgggcacaaactttattgatgcgctgcgtttattcgaaaatgatccg
caaacaaacgcggtaattatgattggtgaaattggcggaaatgcagaagaacgcgctgca
gaatttattcgccatgaaatgattaaacccgtcgtaggttatattgccggtgttactgca
ccaaaaggaaaacgtatggggcacgccggagccattatttctggcggtagcggcagtgcg
gaggataaattccgggcgttcgataaagcaggtatggcatggacacgaaatccagcatta
cttggcgatacattatggaatgttattaaataa

DBGET integrated database retrieval system