KEGG   Escherichia albertii: EAKF1_ch2344cHelp
Entry
EAKF1_ch2344c     CDS       T03986                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
eal  Escherichia albertii
Pathway
eal00051  Fructose and mannose metabolism
eal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EAKF1_ch2344c
Enzymes [BR:eal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     EAKF1_ch2344c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AHE60216
UniProt: W0AQ81
Position
complement(2495805..2496953)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTV
SGVNAVSSIGDDVVDLIVQVDLVTTAVGPVVLERIAPAIAQGLVKRKEQGNESPLNIIAC
ENMVRGTTQLKGHVMNALPEDAKAWVEAHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRTVVKGAMEESGAVLIKRYGFDADKHTAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLVKPLLGTLEYGLPHKNLIQGIAAAMHFRSEDDPQAQELAALIADKGPQAALAH
ISGLDANSEVVTEAVTAYNAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggttttatcggtaaactgctg
gcggacgcaggtatccaactgacgtttgccgatgtcaatcaggtggtacttgatgccctg
aatgcccgtcatagctatcaggttcacgtggttggcgaaaccgagcaagtggataccgtc
tccggtgtaaatgccgtcagcagcatcggcgacgacgtagtggatttaatcgttcaggtt
gatttagtcaccaccgcagtcggcccggtcgtgctggaacgtattgctccggcaatcgct
caagggctggtgaaacgtaaagagcaaggtaatgaatccccgctgaacatcatcgcttgt
gaaaacatggtgcgcggtaccacgcaactgaaaggccatgtgatgaacgctctgccggaa
gacgccaaagcgtgggtcgaagcgcacgttggctttgttgattccgccgttgaccgcatc
gtgccgccttccgcgtctgcaactaacgatccgctggaagtgacggtagaaaccttcagc
gaatggattgtcgataaaacccaattcaaaggcgcgctgccgaacatccctggcatggag
ctaaccgataacctgatggcctttgtcgagcgtaaactcttcaccctgaacaccggccat
gctataaccgcgtacctcgggaaattggccggtcaccagaccattcgtgacgcgatcctc
gacgagaaaatccgcacggtggtaaaaggcgcgatggaagaaagcggtgcggttctgatt
aaacgctatggttttgacgctgacaaacacacggcatatatccagaaaatccttggtcgt
tttgaaaatccatacctgaaagatgatgtggagcgcgtaggccgtcagccgctgcgtaaa
ctgagcgcgggcgaccgtctggtaaaaccgctgctgggtacgctggaatacggcctgccg
cataagaacctgattcagggcattgccgcagcaatgcatttccgcagtgaagatgatccg
caggcacaagagctggcggcactgattgccgataaaggtccgcaggctgcgctggcgcac
atttccgggcttgatgccaacagcgaggttgtcaccgaagccgtaaccgcttataacgca
atgcaataa

DBGET integrated database retrieval system