KEGG   Escherichia albertii: EAKF1_ch3139c
Entry
EAKF1_ch3139c     CDS       T03986                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
eal  Escherichia albertii
Pathway
eal00230  Purine metabolism
eal01100  Metabolic pathways
eal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EAKF1_ch3139c (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AHE60993
UniProt: W0ATU8
Position
complement(3294246..3294725)
AA seq 159 aa
MNHSETITIECTINGMPFQLHTAPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAILAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEETK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacgattaccatcgaatgcaccattaacgggatgccttttcagctt
cacaccgcgccaggcatgccgctctcggaactacttcgcgagcaaggactgcttagtgtc
aaacaaggttgttgcgtgggcgaatgtggtgcctgtacggtgctggttgacggcaccgcg
atagacagttgtttatacctggcggcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggcaaactatcccatgtccagcaggcttatgcgaaatccggcgca
gtgcaatgcgggttttgtacgccgggccttattatggctaccacggcaatactggcgaaa
ccacgcgagaaaccattaaccattacggaaattcgtcgcggcctggcagggaatctgtgc
cgttgcacaggatatcaaatgattgtaaatacggttctggattgcgaggaaacaaaataa

DBGET integrated database retrieval system