KEGG   Escherichia albertii: EAKF1_ch4342Help
Entry
EAKF1_ch4342      CDS       T03986                                 

Gene name
btuE
Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
eal  Escherichia albertii
Pathway
eal00480  Glutathione metabolism
eal00590  Arachidonic acid metabolism
eal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    EAKF1_ch4342 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EAKF1_ch4342 (btuE)
Enzymes [BR:eal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     EAKF1_ch4342 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: AHE62153
UniProt: W0AX52
Position
4511173..4511727
Genome map
AA seq 184 aa AA seqDB search
MMQDSILTTVVKTIDGEATTLEKYAGNVLLIVNVASKCGLTPQYEQLENIQKTWSDRGFV
VLGFPCNQFLEQEPGSDEEIKTYCTATWGVTFPMFSKIEVNGERRHPLYQKLIAAAPTAV
APKESGFYARMVSKGRAPLYPGDILWNFEKFLVGRDGKVIQRFSPDMTPEDPIVIESIKL
ALAK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagattcaattctgacaaccgtagtgaagacaattgatggcgaagcgaccacg
ctggagaaatatgctggtaatgtgttgctgatcgtcaatgttgcttcgaagtgtggtctg
acgccgcaatatgaacagttagagaatatccagaaaacctggagtgatcgcgggtttgtc
gtgttgggatttccatgcaaccagtttcttgaacaagaacctggcagtgatgaagagata
aaaacttactgcaccgcaacctggggagtgacattcccgatgttcagtaagattgaagtc
aatggcgaaaggcggcatccgttgtaccaaaaactgattgccgctgcgccgacggccgtt
gcgccgaaagagagcgggttctacgcacgaatggttagcaaaggccgtgcgccgttgtat
cctggtgatattttgtggaattttgaaaaatttctggtagggagagacgggaaggtcatt
cagcgtttttccccggatatgacaccggaagatcccatcgtaatagaaagcattaaactg
gcgttggcgaaataa

DBGET integrated database retrieval system