KEGG   Erwinia amylovora CFBP1430: EAMY_0075Help
Entry
EAMY_0075         CDS       T01197                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00770  Pantothenate and CoA biosynthesis
eam01100  Metabolic pathways
Module
eam_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:eam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    EAMY_0075 (coaBC)
Enzymes [BR:eam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     EAMY_0075 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     EAMY_0075 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PALP Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: CBA19017
UniProt: D4HU94
Position
complement(101242..102456)
Genome map
AA seq 404 aa AA seqDB search
MMELTGKRIVLGVSGGIAAYKTPELVRRLRDRGAEVRVVMTDAAKAFITPLSLQAVSGYP
VSDSLLDPAAEAAMGHIELGKWADLVILAPATADLIARVAAGMANDLVTTICLATAAPLA
IVPAMNQQMYRALPTQDNLRLLARRGVMIWGPDSGSQACGDIGPGRMLDPLVIVDHTAAW
ATPVNDLQHLNIMITAGPTREALDPVRFISNHSSGKMGFAIAAAAAKRGATVTLVAGPVE
LPTPQGVNRLDVTTALEMQQAVMGLAASQQIFIGCAAVADYRAASVAGEKIKKQGDEITL
KMVKNPDIVAGVATMQQYRPYVVGFAAETQNVEEYAQQKRARKNLDLICANDVAKSGQGF
NSDTNALHLFWHEGEKILPLSDKQLLGQLLLDEIVSRYDEKNRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgatggaactgaccggaaaacgaattgtactgggcgtcagcggcggtattgcggcatac
aaaacgccagagctggtacgtcggctgcgcgatcgcggcgccgaagtacgagtggtgatg
acggacgccgcaaaagcgtttatcaccccgttaagcctgcaagcggtatcaggttatccg
gtgtccgatagcctgcttgatccggctgccgaggcggcgatgggccacatcgaactgggg
aagtgggccgatctggtcattcttgctcccgctacggctgacctgattgcccgcgtggcg
gccgggatggcgaatgacctggtgaccaccatttgcctggcaacggcggccccgcttgcc
atcgtgccggcgatgaatcagcagatgtaccgcgccctgcccactcaagacaacttacgg
ctgctggcccggcgcggcgtgatgatttggggaccggacagcggcagccaggcctgtggc
gatatcggcccaggccgcatgctcgacccgctggtcattgttgaccacaccgcagcatgg
gcgacccccgtcaacgatctgcaacatcttaatatcatgattaccgctggcccgactcgg
gaagccctggatccggtacgtttcatcagcaaccatagctcagggaaaatgggctttgcc
attgccgccgccgctgcgaaacgcggcgcgaccgtgacgctggttgccggcccggtagag
ttaccgactccgcaaggggtcaatcgacttgacgtcactacggcgctggaaatgcagcaa
gcggtgatgggcctggcggccagccagcagatattcatcggctgcgctgccgtggcagat
taccgtgcagcctcggttgccggggaaaaaatcaaaaaacagggggatgaaatcacgcta
aagatggtaaaaaacccggatattgttgccggggttgcaaccatgcaacagtaccgtcca
tacgtagtaggatttgccgcagaaacacagaatgtggaagaatacgcacaacaaaaacgg
gcgcgcaagaatctggacttgatctgcgccaacgatgttgccaaaagcgggcagggtttc
aacagcgataccaatgcccttcaccttttttggcatgaaggagaaaaaatcttaccgctc
agcgataagcaactccttggccaacttttattagacgagattgtcagccgatatgatgaa
aaaaatcgacgttaa

DBGET integrated database retrieval system