KEGG   Erwinia amylovora CFBP1430: EAMY_0640Help
Entry
EAMY_0640         CDS       T01197                                 

Gene name
gcvT
Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00260  Glycine, serine and threonine metabolism
eam00630  Glyoxylate and dicarboxylate metabolism
eam00670  One carbon pool by folate
eam01100  Metabolic pathways
eam01110  Biosynthesis of secondary metabolites
eam01130  Biosynthesis of antibiotics
eam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EAMY_0640 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAMY_0640 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EAMY_0640 (gcvT)
Enzymes [BR:eam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     EAMY_0640 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: CBA19590
UniProt: D4HWB4
Position
714556..715653
Genome map
AA seq 365 aa AA seqDB search
MIQQTPLFAQHQASGARMVDFHGWMMPLHYGSQMDEHHAVRRDAGMFDVSHMTIVDLHGV
RTREFLRYLLANDVAKLTRPGKALYTAMLNASAGVIDDLIVYFISEEFFRLVVNSATREK
DLAWIAQHAAAYGVELTERDDLSLIAVQGPNAQQKAQSVFDDAQRDAVSGMKPFFGVQAG
ELFIATTGYTGEPGYEIALPNQQAAELWQRLLAAGVKPAGLGARDTLRLEAGMNLYGQEM
DETVSPLAANMGWTIGWEPSDRPFIGREMLELQRAKGTERLVGLVMTEKGVLRNALPVHF
SDADGNMLEGVITSGSFSPTLGYSIALARVPAGIGEQAVVQIRNRAMPVTVTKPVFVRAG
KPVTN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgattcagcaaaccccgttattcgcacagcaccaggccagtggcgcaaggatggtggat
tttcacggatggatgatgccgctgcattacggttcgcaaatggatgagcaccatgcggta
cgccgtgatgccggcatgttcgacgtgtctcatatgaccattgtcgatctgcatggcgtg
cgcacgcgcgaatttctgcgctatctgctggcaaatgacgttgccaaactgacccggccg
ggcaaagccctgtatacggcgatgctgaatgcctctgccggggtgatcgacgatctgatc
gtttactttatcagcgaagaatttttccgcctggtagtgaactcggcaacgcgtgagaag
gatctggcgtggattgcacagcatgcggcggcgtatggcgttgagttgactgaacgagac
gatctgtcgctgattgcggtgcaggggccgaacgcgcagcaaaaagcgcaaagcgtattt
gatgatgcccagcgtgacgccgtcagtgggatgaaacccttctttggcgtgcaggcgggg
gagctgtttatcgctaccaccggttataccggcgagccggggtatgaaatcgccctgccg
aatcagcaggcggctgaactctggcagcggctgctggccgccggcgtcaagcctgccggg
cttggcgcacgcgatacgctgcgccttgaagccggtatgaatctgtacggtcaggagatg
gacgagacggtttctccgctggccgccaatatgggctggaccatcggctgggagccgtct
gaccgcccgtttatcgggcgcgaaatgcttgagctgcaacgcgctaaaggcacggaacgg
ctggttggcctggtgatgactgaaaaaggggtactgcgtaacgcgcttcccgtgcacttc
agcgatgccgacggcaacatgcttgaaggcgttatcaccagcggttcgttctctcccact
ctggggtacagcattgccctggcccgcgttccggccggtattggcgaacaggcggtggtg
caaatccgcaaccgcgccatgccggtcaccgtgaccaaacctgtttttgtccgcgccggt
aaaccggtaacgaattaa

DBGET integrated database retrieval system