KEGG   Erwinia amylovora CFBP1430: EAMY_1385
Entry
EAMY_1385         CDS       T01197                                 

Gene name
ycbG
Definition
(GenBank) UPF0268 protein ycbG
  KO
K09911  uncharacterized protein
Organism
eam  Erwinia amylovora CFBP1430
Brite
KEGG Orthology (KO) [BR:eam00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    EAMY_1385 (ycbG)
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: CBA20335
UniProt: D4I0C8
Position
1465390..1465842
AA seq 150 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYIESSAAQEAVDELLQMENRPIDVLQWITL
HMSPALENRMKQTIRARRKRHFNAEHQHTRKKSIDLEYLVWQRLAALAQRRDSTLSETIV
QLIEDAERKEQYASQMSSLKQDLQAILGKP
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaatatcaacagctggaaaatcttgaaagcgggtggaaatggaaatacctggtcaaa
aaacatcgtgaaggtgaattgattacgcgctatatcgaatcaagcgcggcgcaggaagcc
gtcgacgaactgttgcaaatggagaaccggccgattgatgtgttgcagtggataaccctg
catatgagtccggcgctggaaaaccggatgaaacagactatccgtgcacggcgtaagcgt
catttcaacgcagaacatcagcatacccgcaagaagtcgatagatctggaatatctggtg
tggcaacgtctggccgcgctggctcaacgtcgggacagtacgttatctgaaaccatcgtg
cagttaatagaagatgccgagcgcaaagagcaatatgccagtcaaatgtcttcgctgaag
caagatttgcaggcaatcctcggtaaaccctga

DBGET integrated database retrieval system