KEGG   Erwinia amylovora CFBP1430: EAMY_1781Help
Entry
EAMY_1781         CDS       T01197                                 

Gene name
mqo2
Definition
(GenBank) malate dehydrogenase (acceptor)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00020  Citrate cycle (TCA cycle)
eam00620  Pyruvate metabolism
eam01100  Metabolic pathways
eam01110  Biosynthesis of secondary metabolites
eam01120  Microbial metabolism in diverse environments
eam01130  Biosynthesis of antibiotics
eam01200  Carbon metabolism
Module
eam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAMY_1781 (mqo2)
   00620 Pyruvate metabolism
    EAMY_1781 (mqo2)
Enzymes [BR:eam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     EAMY_1781 (mqo2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CBA20731
UniProt: D4I2M5
Position
1841085..1842740
Genome map
AA seq 551 aa AA seqDB search
MSNFRKTLPVLSLSALLVCSSSWAENPAPQKTDVLLIGGGIMSASLGTFLQELQPGWKQL
MVEKLDGVALESSNGWNNAGTGHSANMELNYTPQRADGSIDVSKALEINEQFMISRQFWA
TQVKRGILHDPHSFINSTPHMSFVWGDNNVNYLSKRYEALQQTTLFQGMKFSTDQNQIKQ
WSPLIIEGRDPQQKVAATWTPVGTDVNYGEITRQLIASLKKDKNFTLETSSEATAFKRNA
DNSWHVTITDVKSGDEHSVDAKYVFIGAGGGALKLLQKTGIPEADNYAGFPVGGSFLVSE
DPEVTKAHTEKVYGQASVGAPPMSVPHLDARFIDGKRVVLFGPFATFSTKFLKNGSLFDL
LSTTTTSNVMPMTHVGLDNFDLVKYLVGQVMLSDDDRFAALKEYYPNARKEDWKLIQAGQ
RVQIIKKDADKGGVLKLGTEIVTDRQKTIAALLGASPGASTAATISLNVIKKLFPEEFNS
PEWQSKIRAIVPSYGQQLNGNVSLTQQVWDDTAATLQLTKPPVIDSKTGKATDAAPQQEK
HAESAQHDMAL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacttcagaaaaacgctccctgttctctccttgtccgctctgctggtatgtagc
agcagctgggctgaaaacccagccccacagaaaacggatgtgctgctgattggcggcggc
attatgagtgcttcactgggcactttccttcaggaacttcagccaggctggaagcagctg
atggtggaaaagctggatggcgtggcgctggagtcctctaacggttggaataacgccggt
acgggccattcggcaaacatggaactgaactacacgccacagcgtgcagacggttccatt
gacgtcagtaaagcactggaaatcaacgaacagtttatgatttcccgccagttttgggcg
actcaggtgaagcgcggcatcctccacgacccgcattcgtttattaactcaaccccacat
atgagcttcgtctggggtgacaataacgtcaactacctcagcaagcgctatgaagcgttg
cagcaaactaccctgttccagggaatgaaattctccaccgatcaaaatcagatcaagcaa
tggtcaccgctgatcattgaaggacgcgatccacagcagaaagttgcagcgacctggact
ccggttggtaccgacgtcaactacggggagatcactcgtcagctgatcgccagcctgaag
aaagataaaaacttcacgctggaaacgtcatctgaagccaccgcgtttaaacgcaatgcc
gataactcatggcatgtcaccattaccgatgtaaaaagcggtgatgagcacagcgttgat
gcaaaatacgtgtttattggtgccggcggtggtgcgttgaagttgttgcagaaaaccggc
atcccggaagcggataactatgcgggcttcccggtgggcggttcgttcctggtgagcgag
gatcctgaagtcactaaagcgcatacggaaaaagtgtacggtcaggcttccgttggcgca
ccgccaatgtcggtaccgcatctggatgctcgctttattgatggtaaacgtgtggttctg
ttcggacccttcgccaccttctccaccaagttcctgaaaaatggctcgttgttcgatctt
ctgagcaccaccaccaccagcaacgttatgccgatgacccatgtcggcctcgataacttt
gacctggtgaaatacctggtgggccaggtgatgttgagcgacgatgaccgttttgctgct
ctgaaagagtactatccgaacgcgcgcaaagaagactggaagctgatccaggctggccag
cgcgtacaaatcatcaaaaaggatgctgacaaaggtggcgtactgaagttaggtaccgaa
atcgttaccgatcggcagaaaaccatcgctgctctgctgggcgcatcgccgggcgcatca
acagcggcaactatctcgctcaacgtgataaagaaactgttccctgaagagttcaactca
cccgagtggcagagcaaaatccgcgctatcgttccaagctatggccagcagctgaacggc
aacgtgtcattaacccagcaggtttgggatgacaccgcagctaccctgcaactgactaaa
ccaccggtaattgatagcaaaaccggtaaagccaccgacgccgcgccacagcaagaaaag
catgctgaaagcgcgcaacatgatatggcgctgtaa

DBGET integrated database retrieval system