KEGG   Erwinia amylovora CFBP1430: EAMY_1919Help
Entry
EAMY_1919         CDS       T01197                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00260  Glycine, serine and threonine metabolism
eam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eam01100  Metabolic pathways
eam01110  Biosynthesis of secondary metabolites
eam01130  Biosynthesis of antibiotics
eam01230  Biosynthesis of amino acids
Module
eam_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAMY_1919 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAMY_1919 (trpB)
Enzymes [BR:eam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EAMY_1919 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBA20869
UniProt: D4I3E6
Position
1986191..1987381
Genome map
AA seq 396 aa AA seqDB search
MTRLNPYFGEFGGMYVPQILMPALLQLEDAFISAQSDPAFQAEFTDLLKNYAGRPTALTL
CKNLTKGSKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGAATLKDACNEALRDWSGSY
ETTHYMLGTAAGPHPFPTIVREFQRMIGEETKKQILQQEGRLPDAVIACVGGGSNAIGMF
ADFIDESGVELIGVEPGGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTSDGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRANYVSITDDEALDAFKALCRSEGIIPALESSHALAHALKM
ARENPEKEQLLVVNLSGRGDKDIFTVHDILTAKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtttaaatccttattttggtgagtttggcggcatgtatgtgccgcagatcctg
atgcctgccctgctgcagctggaagatgcttttatcagcgcgcaaagcgatccggcattt
caggctgaatttaccgacctgctgaaaaattatgctggccgtccaaccgcgctgacactg
tgtaaaaacctgaccaaaggcagcaaaacgcgcctttatctgaagcgtgaagatctgctg
cacggcggcgcgcacaaaaccaatcaggtgctgggccaggcactgttggccaagcgcatg
ggcaaaaacgaaattattgctgagacgggtgccggtcagcatggcgttgcctcggcgctg
gcctgcgcgctgcttggcctgaaatgccgtatctatatgggtgcgaaagatatagagcgc
cagtcgcctaacgtatttcgtatgcgcctgatgggtgcggaagtgatcccggtgcacagc
ggtgctgccacgttgaaagatgcctgtaacgaggcgctgcgcgactggtccggcagctac
gaaaccactcactatatgctgggtacggcggctggccctcatccgttcccgaccatcgta
cgcgaattccagcgcatgattggtgaagagactaaaaagcagatcctgcaacaggaaggc
cgcctgccggatgcggtcatcgcctgtgtcggcgggggttctaacgccatcggcatgttt
gctgactttatcgatgaatccggcgtggagctgattggcgtggaaccgggcggtcatggt
attgaaagcggcgaacatggcgctccactcaagcacgggcgagtcggtatttattttggc
atgaaatcaccgatgatgcagacatctgacgggcagattgaagaatcttactcgatttca
gccggtctcgacttcccttccgtcggcccgcagcatgctcacctcaacagtatcggccgg
gcgaactacgtatcaattaccgatgacgaagcgctggatgcctttaaagcgctgtgccgc
agcgaggggattatcccggcgctggaatcctcacatgcgctggcccatgcgctgaaaatg
gcgcgcgaaaatcctgaaaaagagcagctgttagtggtcaatctttccggccgtggtgac
aaagacatcttcaccgtgcacgacatccttaccgctaagggagaaatctga

DBGET integrated database retrieval system