KEGG   Erwinia amylovora CFBP1430: EAMY_2196Help
Entry
EAMY_2196         CDS       T01197                                 

Gene name
adhB
Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:eam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EAMY_2196 (adhB)
Enzymes [BR:eam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     EAMY_2196 (adhB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     EAMY_2196 (adhB)
    1.1.1.-  
     EAMY_2196 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N F420_oxidored ADH_zinc_N_2 Shikimate_DH NTP_transf_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBA21245
UniProt: D4HW47
Position
2235033..2236088
Genome map
AA seq 351 aa AA seqDB search
MKAARWHKAHDIRIEDIEEPLVSAGKVKIKVAWTGICGSDLHEYLAGPIFAPVGKPHKLS
HDVAPIVMGHEFSGKVVAVGNGVTKVKVGDRVVVEPVLSCRTCEACREGKYNLCADLGFH
GLSGGGGGFSSFTVVEEHMVHPMPEGLSYEQGALVEPAAVALHAVRMSKLKAGDKAAVFG
AGPIGLLMIEALRAAGASEIYVVELSPQRAEKARELGANVVIDPSQQDAVATIRERSKGG
VDVAFEVTGVPVVLKQCIDSSRYEGETIIVSIWEGEASFHPNTVVLAERNVKGIIAYRHI
FPAVMELMTQGYFQAEKLVTKRIDLADLVTEGFETLVKEKNQVKILVRPPQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctcgttggcataaagcccatgacattcggattgaagatattgaagaaccc
ctggtcagcgctggcaaggtaaaaattaaagtcgcctggacgggcatctgcggcagcgat
ctgcatgaatatctcgctggcccgatctttgcacctgtcggtaagccgcacaaactcagt
catgacgttgccccgattgtgatgggccacgagttctccggcaaggttgtcgcggtgggc
aacggtgtgactaaagtgaaagtgggtgaccgcgtggtggttgagcctgtcctctcctgc
cgtacctgtgaagcctgtcgcgaagggaaatataatctgtgcgcggatctcggttttcat
ggactgtccggcggcggcggtgggttttcctcctttaccgtggtcgaagaacatatggtg
catcccatgccagagggactttcgtatgagcaaggggcgctggtcgaaccggcagccgtg
gcgttgcacgcggtacggatgagcaagctgaaggccggagataaagcggcggtttttggc
gcgggaccgattggcctgctcatgattgaagccttgcgtgcagcaggtgcatcagagatt
tacgtggtcgagctgtcgccgcagcgggcagaaaaagcgcgcgagctgggagccaatgtg
gttatcgatcccagccagcaggacgcggtggctaccattcgtgaacggagcaaaggcggg
gtagatgttgctttcgaggtgaccggcgtaccggtggtgctgaagcaatgtatcgacagt
tcgcgttacgaaggcgaaacaatcatcgtttccatctgggaaggcgaggcttcgttccac
cccaatacagtggtgctggcagagcgtaacgtaaaaggtatcattgcctatcggcatatt
ttcccggcggtgatggagctaatgacccagggatatttccaggcagaaaagctggtgaca
aagcgcatcgatctcgcggacctggtgactgagggatttgaaacgctggtgaaagaaaaa
aaccaggtgaaaatactggttcgtccaccacaataa

DBGET integrated database retrieval system