KEGG   Erwinia amylovora CFBP1430: EAMY_2827Help
Entry
EAMY_2827         CDS       T01197                                 

Gene name
vraB
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00071  Fatty acid degradation
eam00280  Valine, leucine and isoleucine degradation
eam00310  Lysine degradation
eam00362  Benzoate degradation
eam00380  Tryptophan metabolism
eam00620  Pyruvate metabolism
eam00630  Glyoxylate and dicarboxylate metabolism
eam00640  Propanoate metabolism
eam00650  Butanoate metabolism
eam00900  Terpenoid backbone biosynthesis
eam01100  Metabolic pathways
eam01110  Biosynthesis of secondary metabolites
eam01120  Microbial metabolism in diverse environments
eam01130  Biosynthesis of antibiotics
eam01200  Carbon metabolism
eam01212  Fatty acid metabolism
eam02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAMY_2827 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    EAMY_2827 (vraB)
   00640 Propanoate metabolism
    EAMY_2827 (vraB)
   00650 Butanoate metabolism
    EAMY_2827 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EAMY_2827 (vraB)
   00072 Synthesis and degradation of ketone bodies
    EAMY_2827 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EAMY_2827 (vraB)
   00310 Lysine degradation
    EAMY_2827 (vraB)
   00380 Tryptophan metabolism
    EAMY_2827 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EAMY_2827 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EAMY_2827 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EAMY_2827 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eam04147]
    EAMY_2827 (vraB)
Enzymes [BR:eam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EAMY_2827 (vraB)
Exosome [BR:eam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EAMY_2827 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBA22490
UniProt: D4HZT2
Position
complement(2917995..2919200)
Genome map
AA seq 401 aa AA seqDB search
MAAAQRLLNYQPEEDWQPVIVAACRTPVGRAYGSLANVPPQALLAPLFGKLLAALPAGFT
AIDEVIIGNATGGGGNIARLAALAAGLPLAVPGVTVDRQCGSGLEAVINACRLVQARAGE
CYLAGGVESVSTAPWRVEKPATLRQMPRFYPRARFSPEEIGDPEMGIAAENVARQCAISR
ERQDRFALRSHQRALAAAQQGAFREEIVALNLDRCQVENDECPRPDTSLARLAALPPVFA
ADGSVTAGNCCPLNDGAALLLVMSRRMARDCGFSQGLLFADACSAGVDPNLLGLGPVPAT
QKLLRRQPGLALDRVEVIEFNEAFAAQVLASVDALGIAEHRINQQGGAIALGHPYGASGA
IMVTRLFSQLVSQRQSEGFGLAMLGIAGGLGLSALFKGVRL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcacagcgcttactgaattaccagcctgaagaggactggcagccggtgatt
gtcgccgcctgccgcacgcccgtcggcagggcttatggctcgctggccaacgtgccgccg
caggcgctgctggccccgctgtttggcaagctgctggcggcattacccgctgggtttacg
gcgattgatgaggtgattatcggcaacgccaccggcggcggcggcaatattgcccggctg
gcggcgctggcggccgggttaccgctggcggtgcctggcgtgacggtggaccgccagtgc
ggctccgggctggaagcggtgattaacgcctgtcggctggtgcaggccagggcaggtgaa
tgttatctggccggcggggtagagagcgtcagcaccgcgccctggcgggtggaaaagccc
gccacgctaaggcagatgccgcgcttttatccgcgcgcacgtttttcgccggaagagatc
ggcgacccggaaatgggcatcgccgccgagaacgtggcgcgtcagtgcgccatcagccgg
gaacgccaggaccgctttgcgctgcgcagccatcagcgcgcgctggccgccgcgcagcag
ggcgcattccgcgaggagatcgtcgcgcttaaccttgaccgttgccaggttgaaaacgac
gaatgcccacggcctgatacttcgctggcgcggctggcggcgttaccgccggtatttgcc
gccgatggctcggtgacggcgggtaactgctgcccgctgaatgacggcgctgcgctgctg
ctggtgatgagccgccgcatggcgcgggattgcggcttcagccaggggctgctgtttgcc
gatgcctgtagcgcgggggttgacccgaatttactggggcttggcccggttcccgccacg
caaaagctgctgcggcgtcagccgggcctggcgttggatcgggttgaggtgatcgagttt
aatgaggcttttgccgcccaggtgctggcatcggtagatgcgttgggcattgctgaacac
aggatcaaccagcaggggggcgctatcgcactggggcatccttacggcgcttccggggcg
atcatggtaacgcggctgttcagccagctggtaagtcagcggcagagcgaaggcttcggg
ctggcgatgctggggatcgccggtgggctggggttgagcgcgctgtttaagggcgtgcgg
ctgtaa

DBGET integrated database retrieval system