KEGG   Erwinia amylovora CFBP1430: EAMY_3212
Entry
EAMY_3212         CDS       T01197                                 

Definition
(GenBank) COG3521: putative type VI secretion system, core protein
  KO
K11906  type VI secretion system protein VasD
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eam00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EAMY_3212
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eam02044]
    EAMY_3212
Secretion system [BR:eam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAMY_3212
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: CBA23251
UniProt: D4I219
Position
complement(3302699..3303223)
AA seq 174 aa
MTRVNRRRALTLMACCLLAGCGLTRAVTDGTVNMTKSIFYKKIRMLHLDFTPRTAMNADG
AQIPLATMVRIYQLKDRKAVDAADYRTMLRNADAALKDDLVVSKELLVMPKGSMTLNMPM
DENAQFVAVIGLFNRPDLQDNRWRLVLTRDDPDPDKPRTAELGDGWLSLVPLKE
NT seq 525 nt   +upstreamnt  +downstreamnt
atgacaagagtaaaccggaggcgggcgctaacgctcatggcctgctgcctgcttgcaggc
tgcggcctgacccgtgccgtcaccgacggcacggtaaacatgacgaagtccatcttctat
aaaaaaatcagaatgctgcatctggattttaccccgcgtaccgcgatgaacgccgatggt
gctcagatcccgctggcaaccatggtgaggatctaccagctgaaggaccgcaaggcggtt
gatgcagccgattaccggactatgctgcgcaacgccgacgcggcgctgaaagatgacctt
gtggtgtcaaaagagctgctggtgatgcccaaaggcagcatgacgctgaacatgccgatg
gatgagaacgcgcagtttgttgccgtgatcgggttatttaaccgtcccgatctgcaagac
aaccgctggcggctggtactgacccgtgacgatcctgacccggataaaccgcgcaccgct
gaactgggcgatggctggctcagccttgtgccgctaaaggagtga

DBGET integrated database retrieval system