KEGG   Erwinia amylovora CFBP1430: EAMY_3223
Entry
EAMY_3223         CDS       T01197                                 

Gene name
hcp
Definition
(GenBank) putative type VI secretion system, effector protein hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eam00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EAMY_3223 (hcp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eam02044]
    EAMY_3223 (hcp)
Secretion system [BR:eam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAMY_3223 (hcp)
SSDB
Motif
Pfam: T6SS_HCP ARS2
Other DBs
NCBI-ProteinID: CBA23273
UniProt: D4I230
Position
complement(3319049..3319540)
AA seq 163 aa
MAIPIYLWLKDDGGAAIKGSVNVKDREGSIEVLSQDHSLYMPTDNNTGKLTGTRIHTPFQ
FSKEIDSSSPYLYRAVTSGKKLKSAEFKWYRINDAGQEVEYFNTRLEDVKLVKVAPKMHD
IKDPTKEKHNHLEIIELRYEKITWTYKDGNIIYSDSWDDRPSA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattccaatttatctatggctgaaagacgacggcggcgcggccattaaaggctcc
gtaaatgttaaagaccgtgagggcagcatcgaagttctctcgcaggatcatagcctgtat
atgccaaccgataacaataccggcaaactgacgggcacccgcattcataccccgttccag
tttagcaaagaaatcgattcctccagcccgtacctgtacagagcggtaacctctggcaaa
aagctgaagtctgccgagttcaagtggtacagaatcaacgatgcgggtcaggaagtggag
tatttcaatacccgacttgaggacgtcaagctggtaaaggtcgcgccaaaaatgcacgac
attaaagacccgaccaaagagaagcataatcacctcgaaatcatcgagctgcgttatgaa
aaaatcacctggacctataaagacggcaacatcatttattccgattcctgggacgatcgc
cccagcgcgtaa

DBGET integrated database retrieval system