KEGG   Erwinia amylovora CFBP1430: EAMY_3225Help
Entry
EAMY_3225         CDS       T01197                                 

Definition
(GenBank) putative type VI secretion system-associated hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eam00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EAMY_3225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eam02044]
    EAMY_3225
Secretion system [BR:eam02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAMY_3225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: CBA23277
UniProt: D4I232
Position
complement(3321228..3321905)
Genome map
AA seq 225 aa AA seqDB search
MRQEIDIDQLMTETWLTVTLLRRGATTLDGAALYDNCTKQVENAREALQRAGYDEASIGH
ITYAQCALLDEAVMSRKSVENAHRLDDSQVAWRKAPLQARFFGSLHAGEALWERIAEVLR
QPAPDNAVLTCYHRVIALGFQGLYSVETVSQEQRGEVIKALSERVPMPDADLSLVIHRTA
KHRYSMVRSVWFWVIMTAVLTAGVWWGGHLWLQALLSAQIPELRR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagacaagaaatcgatatcgaccaactgatgacggaaacctggctgaccgtcacctta
ctgaggcggggggccaccacgctggacggcgcagcgctttatgataactgcacgaagcag
gttgaaaacgcccgtgaggcgctgcaacgcgcagggtacgacgaagccagcattgggcat
atcacctacgcccagtgcgccctgctggatgaagcggtgatgagtcgaaaatccgtggag
aatgcacaccggctggatgacagccaggtggcctggcgtaaagcgccgcttcaggcgcgt
ttttttggctccctgcatgccggtgaggcgctttgggagcgtattgcggaagtgctgcgg
cagcctgcaccggataacgcggtgctgacctgttatcaccgcgtcattgcgttgggcttc
caggggctgtacagcgtggagaccgtcagccaggaacagcggggagaggtgattaaggca
ctttctgaacgggtgccgatgcctgatgcggatctgtctctggtgatccaccggaccgct
aaacaccgctacagcatggtgcgctcagtttggttctgggtaatcatgacggccgtactg
acggcgggagtctggtggggcgggcacctttggctccaggcgctgctatctgcgcaaata
ccggagctgcgacgttaa

DBGET integrated database retrieval system