KEGG   Exiguobacterium antarcticum: Eab7_0034Help
Entry
Eab7_0034         CDS       T02258                                 

Gene name
metS
Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00450  Selenocompound metabolism
ean00970  Aminoacyl-tRNA biosynthesis
ean01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ean00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Eab7_0034 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Eab7_0034 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ean01007]
    Eab7_0034 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ean03016]
    Eab7_0034 (metS)
Enzymes [BR:ean01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Eab7_0034 (metS)
Amino acid related enzymes [BR:ean01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Eab7_0034 (metS)
Transfer RNA biogenesis [BR:ean03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Eab7_0034 (metS)
 Prokaryotic type
   Other AARSs
    Eab7_0034 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AFS69197
UniProt: K0A8U7
Position
47834..49831
Genome map
AA seq 665 aa AA seqDB search
MAKTFYITTPIYYPSAKLHIGHAYTTVAGDAMARYKRLQGFDVRYLTGTDEHGQKIQEKA
KEAGVSEQTFVDGVVEQIKVLWDRLDISYDDYIRTTEPRHKEVVERVFETLLEKGDIYLG
EYEGWYSVPDETYYTESQLVDGKSPDSGHPVELVREECYFFRISQYADRLVEYYEANPSF
ILPESRKHEMINNFIKPGLQDLAVSRTTFDWGVKVPSNPKHVVYVWVDALTNYISSLGYG
TDDQGNFDKYWPADVHLVGKEIVRFHTIVWPALLMALDLPLPKQVFAHGWLLMKDGKMSK
SKGNVVDPIPMIDRYGLDALRYYLLREVPFGSDGMFTPEAFVERMNFDLANDLGNLLNRT
IAMITKYFDGVIPTYAGNVTPFDETLSTLAQETVEKVEASMEHMEFSVALSHIWQLISRA
NKYIDETQPWVLAKDETKTAELASSMVHLVGALRHVAIMLQPFMTRSPKEMFRQLGLEGQ
PMDWTALEQFAAINEGTKVGVAQPIFPRRDMKEEVEAIVEMMKQASAARVEEETVEEEVD
ADVRPETTIDVFDQIELRVGEVVTAEKIKKAKKLLKLTVDMGKETRQIVSGIAEWYEPED
LVGRKVIVVANLKPVTLRGELSQGMVLAAEKSGKLELATVPSTMANGASVKIIQMPVDLM
SQAFF
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacattttatatcacaacaccgatttattatcctagcgcaaagctacatatc
ggtcatgcctacacgacggtcgcgggagatgcgatggctcgttacaaacggcttcaaggt
tttgatgttcgttacttgacggggacggacgagcacggacaaaaaattcaagaaaaagct
aaagaagccggtgtatccgagcaaacgttcgttgacggagtcgtcgaacagattaaagtg
ttatgggatcggctcgatatttcgtatgacgattacatccggacaacagaaccgcgccat
aaagaagtcgtcgaacgggtatttgagacattgctcgaaaaaggggacatttatctcggc
gaatacgaaggctggtattctgttccggatgaaacgtattatacggaatcgcagttagtg
gatggaaaaagtcctgacagtggtcacccggtcgaactcgttcgcgaagaatgttatttc
ttccggatcagccaatacgcggatcgcctagttgagtactatgaagcgaacccttcgttc
attttaccagaatcccggaaacatgagatgatcaataacttcattaaacccggtctccaa
gacctcgccgtctcgcggacgacgtttgattggggtgtcaaggtcccatcgaacccgaaa
catgtcgtttacgtttgggttgacgcattgacgaactatatctcgtcactcggctacgga
acggatgaccaaggcaatttcgacaagtattggccagccgacgttcatctggtcgggaag
gaaatcgttcgtttccatacaatcgtttggccggccctgctgatggcgctcgacttacca
cttccgaaacaagtcttcgcacacggctggttgctaatgaaggacggaaagatgtcgaaa
tccaaagggaacgtcgtagatccgattccgatgatcgaccggtacggactcgatgcgtta
cggtattatttgttacgtgaagttccattcggatcggatggtatgttcacaccggaagca
ttcgtcgagcgaatgaattttgatctcgcaaacgatttagggaacttactgaaccggacg
atcgcgatgatcacaaaatatttcgatggcgtcattccgacgtatgctggaaacgtcaca
ccatttgatgagacattgtcgacgctagcacaagaaacggtcgagaaggtcgaagcatcg
atggaacacatggaattttcagtcgccttgtcgcatatctggcaactgatcagccgagcg
aacaagtatatcgatgagacacaaccatgggtactcgcgaaagatgaaacgaaaacagct
gaactcgcttcatcgatggtccatttagtaggggcattacgtcatgttgcgatcatgctc
caaccgttcatgacacggtcaccaaaagagatgttccgtcagcttggactcgaaggacaa
ccgatggactggacagcacttgaacagttcgctgcaatcaacgaaggaacaaaagtcggc
gtcgctcaaccgatcttcccgcgtcgtgacatgaaagaggaagtcgaagccatcgttgaa
atgatgaaacaggcgtctgctgctcgtgtcgaagaagagacagtcgaagaagaagtggat
gctgacgtccgcccagaaacgacgattgatgtgtttgatcagattgaactacgggtcggt
gaggtcgtcacggctgaaaaaatcaaaaaggccaaaaaattgctgaagctaaccgtcgat
atgggcaaagaaacacgtcaaatcgtgtcggggattgccgaatggtatgagccggaagat
ttagtagggcgtaaagtcatcgttgtcgccaacttaaaaccggttacgttacgtggcgaa
ttgtcacaaggtatggtgcttgctgctgaaaaatcaggtaagcttgaactagccacggta
ccatcgacgatggcgaacggggcaagtgtaaaaataattcagatgcctgtggacttgatg
tcacaggcatttttttga

DBGET integrated database retrieval system