KEGG   Exiguobacterium antarcticum: Eab7_0897Help
Entry
Eab7_0897         CDS       T02258                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00260  Glycine, serine and threonine metabolism
ean00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ean01100  Metabolic pathways
ean01110  Biosynthesis of secondary metabolites
ean01130  Biosynthesis of antibiotics
ean01230  Biosynthesis of amino acids
Module
ean_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Eab7_0897 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Eab7_0897 (trpB)
Enzymes [BR:ean01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Eab7_0897 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1971
Motif
Other DBs
NCBI-ProteinID: AFS70041
UniProt: K0ABK4
Position
930643..931842
Genome map
AA seq 399 aa AA seqDB search
MTRYSQPDALGQYGIYGGRYIPETLMQAVLELEQAYAEVKEDPTFYERMNDLLENYVGRK
TPLYYAEHLTRAIGGAKIYLKREDLNHTGAHKINNTIGQALLAERMGKRKIVAETGAGQH
GVATATVCALLDLECVIFMGEEDIRRQELNVFRMELLGAKVVSVTQGSRTLKDAVNEALR
YWVKHVDDTHYLMGSVLGPHPFPEIVRDFQAIIGQETRAQILEKEGKLPEAIVACVGGGS
NAIGMFHPFIEDEDVALYGIEAAGSGLDTDKHAATMSKGEVGVLHGSMMYLLQDDHGQVT
EAHSISAGLDYPGVGPEHSLLKDIGRVQYEAVTDQQALDALQLLCQKEGIIPALETAHAI
AHATELAKEMQPEEVVVICLSGRGDKDVMTVRNALKEEA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacacgttattcacaaccggatgcactgggacaatacggaatctacggaggacgttat
attccggaaaccttgatgcaagccgttcttgaactcgaacaagcctatgcggaagtgaaa
gaagacccgactttttatgaacggatgaatgacttgctcgaaaactatgttggtcgaaaa
acaccactttattatgccgagcatttaacacgagccatcggtggggcaaaaatttattta
aaacgcgaagatttgaatcataccggtgctcataaaatcaataatacgattggtcaagca
ctgctcgctgaacgaatggggaaacgaaaaatcgtagcggagacgggtgccggacaacat
ggtgtcgcgacggcgaccgtctgtgccctgcttgatttagaatgtgtcattttcatggga
gaagaagatattcgccgtcaggaactgaacgttttccggatggagttactgggtgcgaaa
gtcgtttccgtgacacaagggagccggacgttaaaagatgccgtcaatgaagcgttacgt
tactgggtcaaacatgtcgatgatacgcattacttgatgggctccgtcctcggaccacac
ccgttcccggaaatcgtccgtgatttccaagccatcatcggtcaagagacgcgggcacaa
atccttgaaaaagaggggaaattaccggaagcgatcgtcgcttgtgtcggcggaggaagt
aatgcaatcgggatgttccatccgttcatcgaggatgaagacgtcgcgttatacggcatc
gaagcagcgggaagtggactggatacggataaacacgcagcgacgatgtcaaaaggggaa
gtcggggtcttacatggctcgatgatgtatctgttgcaagatgaccatggtcaagtgacg
gaagcccattcgatttcagccggactggattatcctggtgtcggtcccgaacatagtctg
ttaaaagatattggccgtgtccagtatgaggccgtcacggatcaacaggcactggatgcc
ctgcaattgttgtgtcaaaaagaaggcatcattccagcgcttgaaacggcgcatgccatc
gctcatgcaacagaacttgccaaagagatgcaaccggaagaagtcgtcgtcatctgtctg
tcaggacgcggcgataaagatgtcatgacagtcagaaatgctttgaaggaggaagcctga

DBGET integrated database retrieval system