KEGG   Exiguobacterium antarcticum: Eab7_1131Help
Entry
Eab7_1131         CDS       T02258                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00071  Fatty acid degradation
ean00072  Synthesis and degradation of ketone bodies
ean00280  Valine, leucine and isoleucine degradation
ean00310  Lysine degradation
ean00362  Benzoate degradation
ean00380  Tryptophan metabolism
ean00620  Pyruvate metabolism
ean00630  Glyoxylate and dicarboxylate metabolism
ean00640  Propanoate metabolism
ean00650  Butanoate metabolism
ean00900  Terpenoid backbone biosynthesis
ean01100  Metabolic pathways
ean01110  Biosynthesis of secondary metabolites
ean01120  Microbial metabolism in diverse environments
ean01130  Biosynthesis of antibiotics
ean01200  Carbon metabolism
ean01212  Fatty acid metabolism
ean02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ean00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Eab7_1131
   00630 Glyoxylate and dicarboxylate metabolism
    Eab7_1131
   00640 Propanoate metabolism
    Eab7_1131
   00650 Butanoate metabolism
    Eab7_1131
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Eab7_1131
   00072 Synthesis and degradation of ketone bodies
    Eab7_1131
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Eab7_1131
   00310 Lysine degradation
    Eab7_1131
   00380 Tryptophan metabolism
    Eab7_1131
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Eab7_1131
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Eab7_1131
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Eab7_1131
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ean04147]
    Eab7_1131
Enzymes [BR:ean01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Eab7_1131
Exosome [BR:ean04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Eab7_1131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFS70270
UniProt: K0ABJ9
Position
1159023..1160213
Genome map
AA seq 396 aa AA seqDB search
MSEQVVIVSATRTAIGSFNGSLKDVKVTTLGATVIRAALEQANVAPNLVEEVIMGNVLQA
GLGQNPARQASLLAGLPETVPAMTINKVCGSGLKAIHLAFQAIKSGEADIIVAGGMENMS
QAPYVLSGARTGLRMGDQPLVDTIIKDGLECAFNDYHMGITAENLADQYAISREAQDQFA
ATSQQKASQAIEADRFQAEITPVEIPQRKGEPVVFTQDEFPRAGTTNESLARLRPAFKKD
GTVTAGNASGINDGAAAVVVMSARKAKELGLTPLVEIVANGTSGVDPSIMGIGPVKAVGQ
ALQKAGLELDAIEVIEANEAFAAQSLAVDAELQFDPAKLNRNGGAIALGHPIGASGTRIM
VTLIHEMLRTGESHGLATLCIGGGQGIATIVKKYEA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaagttgtcatcgtcagtgcgacacgaacggcaatcggcagttttaacggc
agtttaaaagatgtcaaggtaacgacgcttggggcgacggtcatccgggcagcactggaa
caagcgaacgtcgcgcccaatctcgtcgaagaagtcatcatgggcaacgtccttcaggca
ggactcggacaaaatccggcgcgtcaggcaagtctcctcgccggtcttccggaaacggtt
ccggcgatgacgatcaataaagtctgtggttccggcttaaaggcgattcatctcgcgttt
caggcgatcaagtccggagaggcggatatcatcgtcgccggcgggatggaaaacatgagc
caggcgccgtacgtgttaagtggtgcccggaccggcttacggatgggagaccagccgctt
gtcgatacgatcatcaaggacggactcgaatgtgcctttaacgattaccatatggggatc
acagcggaaaatttagcggatcaatacgcaatttcccgggaggcgcaagaccagtttgca
gcgacaagtcaacaaaaagcaagccaagccattgaagcggatcgtttccaagcggaaatc
acaccggttgaaattccgcaacgtaaaggcgagcctgtcgtattcacgcaagatgagttc
ccgcgtgccggtacgacaaacgagtccctcgcacgactgcgcccggccttcaagaaggac
gggacggtgacggccggtaacgcatccgggatcaatgacggagcggcagcagtcgtcgtc
atgtctgctcgcaaagcgaaagaactcggactgacacccctcgtcgagattgtcgcaaac
ggcacgtccggcgtcgacccgagtatcatggggatcggtccggtcaaggcggtcggacag
gcgttgcaaaaagccggtcttgaacttgacgccatcgaggtcatcgaggcgaacgaagcg
tttgctgcgcaatcacttgcggttgacgcggaacttcaatttgacccggcgaagttgaac
cgaaacggcggggcgattgcactcggtcatccgatcggcgccagcggcacacggatcatg
gtgacattgatccacgagatgttacggaccggcgaaagccatggtctcgcgacactttgc
atcggcggcggtcaagggattgcgacgattgtcaagaaatacgaagcgtaa

DBGET integrated database retrieval system