KEGG   Exiguobacterium antarcticum: Eab7_1858Help
Entry
Eab7_1858         CDS       T02258                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00010  Glycolysis / Gluconeogenesis
ean00020  Citrate cycle (TCA cycle)
ean00620  Pyruvate metabolism
ean01100  Metabolic pathways
ean01110  Biosynthesis of secondary metabolites
ean01120  Microbial metabolism in diverse environments
ean01130  Biosynthesis of antibiotics
ean01200  Carbon metabolism
Module
ean_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Eab7_1858 (pdhC)
   00020 Citrate cycle (TCA cycle)
    Eab7_1858 (pdhC)
   00620 Pyruvate metabolism
    Eab7_1858 (pdhC)
Enzymes [BR:ean01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Eab7_1858 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFS70966
UniProt: K0AEK0
Position
complement(1811561..1812856)
Genome map
AA seq 431 aa AA seqDB search
MGLFEWKLPDIGEGIHEGEIVKWFVKAGDTIKEDDILLEVQNDKAVVEIPSPVDGTVKEV
KVDEGVVAIVGDVLITFEVEGEGSAPSEEAVEQPKAADNAKDVQDTDKKVEDKPTEVQIH
KSERVIAMPSVRKYAREKGVDIREVQGSGDNGRVVKEDIDAFANGGQSSTAPAAEEKAPA
AQASAAKSEVKPYVAAQPELETREKIKGIRKAISKAMVNSKHTAPHVTLMDEVDVTNLVA
LRKNFKEVAAAQGTKLTYLPFVVKALTAAAKKYPAINASIDDVNEEVVYKNYFNIGIAAD
TDNGLVVPVVKDADRKSIFALADNINDLAGKAREGKLSGEEMKGGSITITNIGSAGGQWF
TPVINHPEVAILGIGRIAEKAVVKNGEIVAAPVLALSFSFDHRLIDGATAQNALNLVKRL
LNDPQLLIMEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgggtttatttgaatggaaattaccagatatcggtgagggtattcatgaaggtgaaatc
gtaaagtggttcgttaaagcaggcgacacaatcaaagaagatgatatccttctagaagtc
caaaacgataaagctgtcgttgaaatcccgtcaccagttgacggtactgtcaaagaagta
aaagtagacgaaggtgttgttgccattgttggcgacgtgttgatcacgttcgaagttgaa
ggcgaaggttctgctccttctgaagaagcggtcgagcagcctaaagcggcagataatgcg
aaagatgtccaagacacagacaaaaaagtcgaagacaaaccaacagaagtccaaatccat
aaatcagaacgcgtcatcgcgatgccatcagtacgtaagtacgcacgtgaaaaaggtgtc
gacatccgcgaagttcaaggttctggtgacaacggtcgtgtcgtcaaagaagacatcgat
gcattcgcaaacggtggacaatcttcaactgcaccagcagcagaagaaaaagcaccagct
gcacaagcttcagctgctaaatctgaagtgaaaccgtatgtcgcagctcaacccgagctc
gaaacgcgtgagaagatcaaaggaatccgtaaagcgatttcaaaagcaatggttaactcg
aaacacacagcaccacacgtaacgttgatggatgaagtagacgtgacgaatcttgtggct
ctccgtaaaaacttcaaagaagttgcggcagcacaaggtacgaaattgacttaccttccg
ttcgtcgtcaaagcgttgacagcagcagctaaaaaataccctgcgatcaatgcatcaatc
gatgacgtgaacgaagaagtcgtttacaaaaactacttcaacatcggtatcgcagcagat
acagacaatggtcttgttgttcctgtcgtcaaagatgcagatcgtaaatcgatcttcgca
ttagcagacaacatcaatgatcttgctggtaaagcacgcgaaggtaaattgtctggtgaa
gagatgaaaggtggatcgatcacgatcactaacatcggttctgctggtggacaatggttc
acacctgtcatcaaccacccagaagtagctatcctcggtattggccgtatcgctgaaaaa
gcggttgttaaaaacggtgaaatcgttgcagcaccagtactcgcattgtcattcagcttt
gaccaccgtctcattgatggtgctacagcacaaaacgcgcttaacttggttaaacgtttg
ttgaacgacccacaacttctcattatggagggataa

DBGET integrated database retrieval system