KEGG   Exiguobacterium antarcticum: Eab7_2015Help
Entry
Eab7_2015         CDS       T02258                                 

Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00061  Fatty acid biosynthesis
ean00071  Fatty acid degradation
ean01100  Metabolic pathways
ean01212  Fatty acid metabolism
ean02024  Quorum sensing
Module
ean_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ean00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Eab7_2015
   00071 Fatty acid degradation
    Eab7_2015
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Eab7_2015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ean01004]
    Eab7_2015
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ean04147]
    Eab7_2015
Enzymes [BR:ean01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Eab7_2015
Lipid biosynthesis proteins [BR:ean01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Eab7_2015
Exosome [BR:ean04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Eab7_2015
  Exosomal proteins of breast cancer cells
   Eab7_2015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFS71118
UniProt: K0AC61
Position
complement(1968811..1970484)
Genome map
AA seq 557 aa AA seqDB search
MDSVWLKDYPEQVPASIDYREVPLYQALEEAADDFPERRALSFLGKRMTFQEVRQEARRF
AHVLQEAGLEKGDRVGLMLPNCPQYMISYYAVLYAGGTVVQVNPLYTDRELEQILVDSGA
KILVTLDLLYPKASRVKAVTALQTVVTTSIADYLPFPKNKLYPIKSRKDNNIIIDTTGSI
PFLSHRGHESIEPVEINPKEDIAVLQYTGGTTGAPKGVMLTHFNLSANVEQISRWFYKYS
RGDGRKLLAVVPYFHVYGMTCNLNFGMFNAYEQIILPKFDIEQVLKAIDKEKPNLFPGAP
TMYVGLLNHPKLKKYDLSSIEACISGSAPLPVEVQEKFEQVTGGRIVEGYGLSETSPVTH
TNCIWDKRVPGTVGIPVPDTIAKIVQGDGETAAAPGEIGEILVRGPQVMKGYWKRPEDTQ
AVLRDGWLHTGDLGYVGEDHYFRIVDRKKDLIIASGFNIYPREVEEILYEHPAVKEAVVI
GVPDAYRGETVKAFIVLKDDGTVTEEELDQFCRKSLASFKVPKQYEFRQELPKTFVGKIL
RRVLIEEERAKQLEESS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggattcagtatggctaaaggattatccagaacaggtacctgcatcaatcgactatcgt
gaggtgccactttatcaagcgttagaggaggcagctgacgattttccagaacgtcgtgcc
cttagttttctcggtaaacggatgacttttcaggaagtgcgacaagaagcacgtcgtttt
gcacacgtcttacaggaagctggactcgaaaaaggagatcgtgttggtttgatgttaccg
aactgtccgcagtatatgatcagttattatgctgtgttgtacgcaggcggaacggtcgtt
caagtcaatccgctctatacggaccgggaactggaacaaattcttgtcgactcgggtgcc
aagattcttgtgacactggatttactgtatccaaaagcatcacgcgtcaaagcggtgact
gcattacaaaccgttgtcacgaccagtattgctgactatcttcctttccccaaaaataag
ctgtatccgatcaaatcccggaaagacaacaatatcatcatcgatacgacgggatcgatt
ccttttttatcgcatcgtggacacgaatccatcgagccggtagaaatcaatccaaaagaa
gacatcgcagtgttacaatataccggtggaacgaccggagccccaaaaggagtcatgttg
acacattttaatttgagtgcgaacgtcgaacaaatcagccgctggttttataaatattcg
cgtggtgatggacggaaattattggccgttgtcccttatttccatgtctacggcatgacg
tgtaatctgaatttcgggatgtttaatgcctatgaacaaatcatcttaccgaaatttgat
attgaacaagtcttaaaggcaattgataaagaaaaaccaaacttattcccaggggcaccg
acgatgtatgttggactcctgaatcatccgaaactgaaaaaatatgacttgtcgtcgatt
gaagcctgtatctccggatcagcgccgttaccagtcgaagtgcaagaaaagtttgaacag
gtgacgggtggacgaattgtcgaagggtatggattatcagagacaagtccggtcacacac
acgaattgcatttgggacaaacgtgttcccggaacagttggcattcctgttccggatacg
attgcgaaaatcgttcaaggtgacggtgagaccgcggcagcacctggagagattggtgaa
attctcgttcgaggtccacaagtcatgaaagggtactggaagcgtcctgaagatacgcaa
gccgtcttacgtgacgggtggctgcatacgggcgatcttggttatgtcggagaagatcat
tacttccgaatcgtcgaccggaaaaaagatttaatcatcgcctctggtttcaacatctat
ccacgagaagtcgaagaaattctatacgaacatccagccgtcaaagaagctgttgtgatt
ggagtgccggacgcgtatcgaggagagacggtaaaagcgtttatcgtgctcaaagatgat
ggtacagtgacggaagaagaactcgatcagttttgccggaaaagtcttgcttctttcaaa
gttccgaaacagtatgagttcagacaagaactcccgaaaacgtttgtcgggaaaattctg
cgccgtgtcctgattgaagaagaacgggcaaaacagctggaagaaagcagttga

DBGET integrated database retrieval system