KEGG   Exiguobacterium antarcticum: Eab7_2238Help
Entry
Eab7_2238         CDS       T02258                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00010  Glycolysis / Gluconeogenesis
ean00051  Fructose and mannose metabolism
ean00562  Inositol phosphate metabolism
ean01100  Metabolic pathways
ean01110  Biosynthesis of secondary metabolites
ean01120  Microbial metabolism in diverse environments
ean01130  Biosynthesis of antibiotics
ean01200  Carbon metabolism
ean01230  Biosynthesis of amino acids
Module
ean_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ean_M00002  Glycolysis, core module involving three-carbon compounds
ean_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ean00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Eab7_2238 (tpiA)
   00051 Fructose and mannose metabolism
    Eab7_2238 (tpiA)
   00562 Inositol phosphate metabolism
    Eab7_2238 (tpiA)
Enzymes [BR:ean01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Eab7_2238 (tpiA)
Exosome [BR:ean04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Eab7_2238 (tpiA)
  Exosomal proteins of bladder cancer cells
   Eab7_2238 (tpiA)
  Exosomal proteins of melanoma cells
   Eab7_2238 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFS71335
UniProt: K0AEU7
Position
complement(2193520..2194272)
Genome map
AA seq 250 aa AA seqDB search
MRKPIIAGNWKMNLSLKDAVAFAEEVKGTVPASSKVDAAVCAPSVFLAHLTEAAAGTDLK
IGAQNMYDQESGAYTGEISPVMLKDLGVTYVILGHSERREYFGETDAFINSKAKKAFEHG
LVPIVCVGETLEQREGGQFESVIREQTANSLKGLTVDQVKNLVVAYEPVWAIGTGKSATE
QDAQDSCKFVRDVVAAEFGTEAAEAVRIQYGGSVKPENIKEYMAQPDIDGALVGGASLET
GSFLKLLEAI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaagatgaatcttagcctcaaggatgctgtc
gcattcgctgaggaagtcaaaggaactgtacccgcttcttcgaaagtcgacgcggctgtc
tgtgcaccgtctgtattccttgcacatttgacagaagcagcagctggaacagacttgaaa
atcggcgctcaaaacatgtatgaccaagaaagcggcgcatatacaggcgaaatcagcccg
gtcatgctgaaagatcttggcgtgacatacgtcatcctcggtcattcagaacgccgtgaa
tactttggtgaaacagatgcgttcatcaacagcaaagcgaaaaaagcattcgaacacggt
ctcgtgccaatcgtttgtgtcggtgaaacactcgaacaacgcgaaggcggtcaattcgag
tcagtcatccgcgaacaaacggcaaacagccttaaaggattaacagtcgatcaagtgaaa
aaccttgttgtcgcatacgagcctgtctgggcaatcggaacaggcaaatcagcgacagaa
caagatgcacaagattcttgtaaattcgttcgtgacgtcgtcgcggctgaattcggtact
gaagcagctgaagcggtccgtatccagtacggtggcagtgtcaaaccggaaaacatcaaa
gaatatatggctcaacctgacatcgacggtgctctagttggtggcgcaagtcttgagaca
ggatcgttcctcaaactgttggaggcgatttaa

DBGET integrated database retrieval system