KEGG   Elizabethkingia anophelis NUHP1: BD94_0718Help
Entry
BD94_0718         CDS       T03235                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
eao  Elizabethkingia anophelis NUHP1
Pathway
eao00620  Pyruvate metabolism
eao00630  Glyoxylate and dicarboxylate metabolism
eao01100  Metabolic pathways
eao01110  Biosynthesis of secondary metabolites
eao01120  Microbial metabolism in diverse environments
eao01200  Carbon metabolism
Module
eao_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BD94_0718
   00630 Glyoxylate and dicarboxylate metabolism
    BD94_0718
Enzymes [BR:eao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BD94_0718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase Peptidase_C1_2 HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AIL44493
UniProt: A0A077ECW0
Position
732913..734478
Genome map
AA seq 521 aa AA seqDB search
MEKFSIQHSKKYEEIYSAELQLFLTELHEHFNAERQALLDKRKVLQKEFDQGILPRFLKE
TEEIRNGNWICEPLPDSLLDRRVEITGPVDRKMIINAMNSGANCFMADFEDSNSPTWENV
MDGQINLRDLNSRNIDFEIKGKQYILNEKPAVLLVRPRGLHLNEKHILINGEQASGSLID
FGIFFFLNAKKQLENGVGPYFYLPKLESYHESAWWNKVFVFSQNYLGIPQNTIKATVLIE
TITAAFQMDEIIYSLKEHMAGLNCGRWDYIFSFIKKFRKLPEFMLPDRDQVTMTIHFMSS
YSMLLVKTCHKRGVSAMGGMAAQIPVKHDENANEVAFAKVRADKEREVKNGHDGTWVAHP
ALVSVAKEVFDAGMPTPNQIDQKKEEYNIGEADLLTVPQGTITEAGVRKNINVGILYIES
WLVGVGAAAIYNLMEDAATAEISRTQLWQVFHSQKPLENGQYLTKENYLKWQDEELEKIK
EYVGATRYTDGNFALATQLLQDMVFEENFEDFLTLRAYKYI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatttagtattcaacattcaaaaaagtatgaagagatatactctgctgaatta
caattgtttttaacagagttgcatgagcattttaatgctgagagacaagctcttttagat
aaaagaaaggttttgcaaaaagaatttgatcagggaattctgcctcgatttttgaaagag
accgaagaaataaggaatggaaactggatatgtgaaccgctgccggattctttgctggac
aggcgggtagagattacaggtcctgttgaccgtaagatgattattaatgctatgaattcc
ggagccaattgcttcatggctgattttgaagacagtaattcccctacctgggagaatgta
atggatggacagataaatctcagagatttgaatagcagaaatattgattttgaaattaaa
ggaaaacaatatattctgaatgaaaaacctgcagttttgttggtgcgccccagagggctt
catctaaatgaaaaacatattcttattaatggtgagcaggcatcgggttctttaattgat
tttggaatcttcttttttctgaatgctaaaaagcaattggaaaatggagttggaccttat
ttctaccttccgaagctggaaagctatcatgaatcggcatggtggaataaagtttttgta
ttctcgcagaactatcttggaattccacaaaatacaattaaggcaactgttttaatagaa
accattacggcagcttttcagatggatgaaattatttattctctgaaagagcatatggcg
ggactgaactgtgggcgctgggattatattttttcatttattaaaaaattcagaaagctc
cctgaatttatgttgccggacagagatcaggtgacaatgacgatccattttatgagttcg
tactcaatgcttttggtaaaaacctgtcataaaagaggcgtttcggcaatgggaggtatg
gctgcgcaaattcctgtaaaacatgatgagaacgccaacgaagtagcttttgcaaaagta
cgtgcagataaagaacgtgaagtgaagaacggtcatgacggtacatgggtggcgcatccg
gctttggtaagtgttgccaaagaggttttcgatgccggaatgcctacccctaatcagatt
gaccagaaaaaagaagaatataatattggtgaagcggatctgctgactgttccacaaggg
acaattaccgaagcaggtgtacgcaagaatattaatgtgggaattctctatatcgaatcc
tggctggtaggggttggtgctgcggctatttacaatctgatggaagatgctgcgacagca
gaaatttccagaacccaattgtggcaggtatttcattcacaaaaacctttagaaaatgga
caatatcttacaaaagaaaactatctgaaatggcaggacgaagagctcgagaagataaaa
gaatatgtaggcgctacacgatacaccgatgggaactttgcactggcaacacagctgctg
caggatatggtttttgaagaaaattttgaagattttctaacattaagagcttataaatac
atctga

DBGET integrated database retrieval system