KEGG   Klebsiella aerogenes EA1509E: CCG29257Help
Entry
CCG29257          CDS       T02447                                 

Definition
(GenBank) Inner membrane protein forms channel for type IV secretion of T-DNA complex (VirB8)
  KO
K03203  type IV secretion system protein VirB8
Organism
ear  Klebsiella aerogenes EA1509E
Pathway
ear03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ear00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CCG29257
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ear02044]
    CCG29257
Secretion system [BR:ear02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   CCG29257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: CCG29257
Position
complement(491995..492678)
Genome map
AA seq 227 aa AA seqDB search
MSEQKLIAESRTFEQQMIERDKRATKAGFVVGGMGLLIAVLALVAVVVMLPLKQTDVELY
TLDNHTGRVEHVTRTSKTSLTATEAYQKAMAANYVKVRERYVYPSLQDDYETVQVYNAPQ
VNDDYLALYAGKNAPDKVYKNGAHTVKVEILSNQITDATAPDRVATIRYKKIIRRLADNS
TRNEYWDARFTFHSNPDKEMSDAEREINYFGFTVTSWQTDREIRGGE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacagaaattaatagctgaatcccgcacttttgagcagcaaatgattgagcgg
gataaacgcgccacaaaagccggttttgttgttggcggtatgggtctgctgattgcggta
ctggcgctcgtcgccgtggtcgtgatgttgccgctgaaacagacggacgttgagctgtat
accttggataaccacacaggacgggtggaacacgttacccggacatcgaaaaccagcctg
accgcaacagaagcctatcaaaaggcgatggccgcaaactacgtcaaagtgcgtgagcgg
tatgtctatccctctttgcaggacgactacgagacggtacaagtctacaacgctccccag
gtaaacgatgactatctggcgctttacgccggaaaaaacgccccagacaaggtttataag
aacggggcgcacaccgtgaaagtggagatcttgtccaaccagatcaccgatgcgacagcc
cctgatagggtcgccaccatccgctacaagaagattatccgccgtctggctgataacagc
acccgcaacgaatattgggatgcccggttcacgttccattctaaccctgacaaggaaatg
agcgatgcggaacgcgagatcaactacttcggctttaccgtcaccagttggcagaccgac
cgcgaaatccggggaggtgaatga

DBGET integrated database retrieval system