KEGG   Klebsiella aerogenes EA1509E: CCG30385Help
Entry
CCG30385          CDS       T02447                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase (EC 2.3.1.16); Acetyl-CoA acetyltransferase (EC 2.3.1.9)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ear  Klebsiella aerogenes EA1509E
Pathway
ear00071  Fatty acid degradation
ear00072  Synthesis and degradation of ketone bodies
ear00280  Valine, leucine and isoleucine degradation
ear00310  Lysine degradation
ear00362  Benzoate degradation
ear00380  Tryptophan metabolism
ear00620  Pyruvate metabolism
ear00630  Glyoxylate and dicarboxylate metabolism
ear00640  Propanoate metabolism
ear00650  Butanoate metabolism
ear00900  Terpenoid backbone biosynthesis
ear01100  Metabolic pathways
ear01110  Biosynthesis of secondary metabolites
ear01120  Microbial metabolism in diverse environments
ear01130  Biosynthesis of antibiotics
ear01200  Carbon metabolism
ear01212  Fatty acid metabolism
ear02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ear00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCG30385
   00630 Glyoxylate and dicarboxylate metabolism
    CCG30385
   00640 Propanoate metabolism
    CCG30385
   00650 Butanoate metabolism
    CCG30385
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CCG30385
   00072 Synthesis and degradation of ketone bodies
    CCG30385
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCG30385
   00310 Lysine degradation
    CCG30385
   00380 Tryptophan metabolism
    CCG30385
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCG30385
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCG30385
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CCG30385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ear04147]
    CCG30385
Enzymes [BR:ear01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CCG30385
Exosome [BR:ear04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCG30385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CCG30385
Position
1631779..1632960
Genome map
AA seq 393 aa AA seqDB search
MKEVAIVCALRTPIGSFRGALSSLSAVELGAAVVRGLLERKQLPARAVDELIFGQVLTAG
CGQNPARQTALRAGLPVETPAVTVNLVCGSGLKAVQQAVQAIRSGEAEIVIAGGQESMSN
APYLVQGARDGLRFGHASMQDSMIQDGLWDAFNDYHMGITAENLADAFDISRPQQDAFAA
LSQRKAAAAIAAGRFQAEIVPLSVPQGKKAPRMVDADEQPRPETSEQQLAQLRPAFRTED
GSVTAGNASSLNDGAAAVLLMSVDKARQLGLPVLARIVSSAVAGVDPSVMGIGPVSACRK
ALQRAGWSLDEVDLIEANEAFAVQALAVGKLLEWDSQKVNVNGGAIALGHPIGASGCRIL
VSLLHEMQRRDVSKGLATLCVGGGQGIAMTIER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtcgctatcgtctgcgcgctacgtacgccaatcggcagttttcgcggcgcc
ttgtcttccctttccgccgtcgagcttggcgccgccgtagtgcgtggtctgcttgaacgc
aaacagctaccggccagagccgttgacgaactgatttttggccaggtattaaccgccggc
tgcggacagaatccggcgcggcaaaccgcgctgcgcgcagggctaccggttgaaactccg
gccgttaccgtcaatctggtttgcggttccgggctgaaagctgtgcaacaggcggtacaa
gccattcgcagcggcgaggcggagatagtgatagccggcggccaggagagcatgagcaat
gctccgtatctggttcagggcgcgcgcgatggcctgcgcttcggccatgccagcatgcag
gacagcatgattcaggacggattatgggatgcgtttaacgactatcacatgggcatcacc
gccgagaatctcgccgacgcctttgatatctcccgcccccagcaggatgccttcgccgcc
ctttcgcagcgcaaagccgccgccgcgatagccgccgggcgctttcaggctgagatagtg
ccgcttagcgtccctcagggtaaaaaagcgccgcgcatggtggacgcagacgaacagccg
cgcccggaaaccagcgaacaacagctggcgcagttgcgccctgcctttcgcacggaggat
ggcagcgtcaccgcgggcaatgcctcttcgctcaacgatggcgcggcggcagtcttatta
atgagcgtcgataaagcgcggcagcttggcttgccggtgctggcgcgaattgtcagctct
gcggtggccggcgtcgatccgtccgtgatgggtatcggcccggtaagcgcttgccggaag
gcgctgcagcgcgccggttggtcgctggacgaggtggatctcatcgaagccaacgaggcc
tttgccgtgcaggcgctggccgttggcaaattgctggagtgggacagccagaaagtcaac
gtcaacggcggcgctatcgcgctcggccatccaattggcgcctcaggatgtcgcattctg
gttagtctgctgcacgagatgcagcgccgcgatgtcagcaaaggcctggcgacgctttgc
gtcggcggcggtcagggtatcgcgatgaccatcgaacgttaa

DBGET integrated database retrieval system