KEGG   Klebsiella aerogenes EA1509E: CCG30811Help
Entry
CCG30811          CDS       T02447                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase (EC 3.2.1.26)
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ear  Klebsiella aerogenes EA1509E
Pathway
ear00052  Galactose metabolism
ear00500  Starch and sucrose metabolism
ear01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ear00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CCG30811
   00500 Starch and sucrose metabolism
    CCG30811
Enzymes [BR:ear01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CCG30811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: CCG30811
Position
2061950..2063350
Genome map
AA seq 466 aa AA seqDB search
MSQPSLLPLVLQAVMNHQPRALRDKHYPQWHLAPVCGLLNDPNGFIHFNGRYHLFYQWNP
LACDHRYKGWGHWSSPDLLHWRHEPIALLPEEEYDRNGCYSGSAVDNNGILTLCYTGNVK
FNDGSRTAWQCLATQNPDGTFRKQGPVLALPAGYSGHVRDPKVWRDGDRWLMVLGARNLA
DRGKVLLFSSTDLMQWNSHGEIAGSGLNGLKDAGYMWECPDLFPLGDRYILLSCPQGLPR
EAQRFLNTYPAVWMQGHFDQTAATWRHGAIEELDSGFEFYAPQTTLAEDGRRLLVGWMGV
PDGEEMQQPTRAHGWIHQMTCLRELSWRHGTLYQNPVRELAALRGEAQGWQTEPLALQPM
ELAFEVAPDDALTLDFAGALQLSLDSRGVRLARRSLVADTVDYRYWRGAAHKLQILIDRS
SVEIFINDGVGVMSSRFFADYPGKLVFSGATPGAFCCWPLRPCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagccttctttgttaccgttggtcctgcaggccgtcatgaaccaccagccgcgc
gcgctgcgggataagcactatccgcagtggcatctggcgccggtatgcgggctactgaac
gatccgaacggttttatccacttcaatggtcgttatcatctgttttatcagtggaatccc
ctcgcctgcgatcaccgctataagggctggggacactggagttcgccggatctgctgcac
tggcggcacgaaccgattgccctgctgccagaggaggagtacgaccgtaacggttgttac
tccggcagcgcggtagataacaacggcatcctgacgctgtgctacaccggtaatgtgaaa
tttaacgatggcagccgtaccgcctggcagtgtctggcgacgcaaaatcccgacggcact
tttcgcaaacagggcccggtgctggcgctgccagcaggctatagcggccacgtgcgcgat
cccaaagtctggcgcgatggcgatcgctggttgatggtgctgggcgcgcgcaatctggcc
gaccgcggcaaggtactgctattcagctctactgatttgatgcagtggaatagccatggc
gaaattgccggtagcggacttaacggcttgaaagacgccggctatatgtgggaatgcccg
gatctgttcccgctcggcgatcggtatattttactgagctgcccgcagggattgccgcgt
gaggcacagcgcttcctgaacacctatccggcagtctggatgcagggccatttcgatcaa
accgccgccacctggcgccatggcgcgatcgaagagctggatagcggcttcgaattctat
gcgccgcaaaccaccctggcggaggatggtcgccgtctgctggttggctggatgggggtt
cccgacggagaagagatgcagcaacctacgcgggcccacggctggatccatcagatgacc
tgcctgcgggaactcagctggcgccacggcacgctgtatcaaaatcccgtgcgcgaactg
gcggcgcttcgcggcgaggcgcaaggctggcagaccgaaccgctggcgctgcagccgatg
gaactggccttcgaggttgcgccagacgatgcgctgacgctggatttcgcgggcgcgctg
cagctttcgctggacagccgcggcgtacgtctggcccgtcgaagcctggtggccgataca
gtcgattaccgttactggcgcggcgcggcgcataaactgcagatcctcatcgaccgttcc
agcgtcgaaatctttattaacgatggcgtgggagtgatgagcagccgcttctttgcggat
tatcctggaaaactggtattcagcggtgcgacgccgggggcattctgctgctggccgctg
cggccatgcatggtagaataa

DBGET integrated database retrieval system