KEGG   Klebsiella aerogenes EA1509E: CCG32465Help
Entry
CCG32465          CDS       T02447                                 

Definition
(GenBank) Glutamate racemase (EC 5.1.1.3)
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ear  Klebsiella aerogenes EA1509E
Pathway
ear00471  D-Glutamine and D-glutamate metabolism
ear01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ear00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CCG32465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ear01011]
    CCG32465
Enzymes [BR:ear01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CCG32465
Peptidoglycan biosynthesis and degradation proteins [BR:ear01011]
 Precursor biosynthesis
  Racemase
   CCG32465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: CCG32465
Position
complement(3814762..3815544)
Genome map
AA seq 260 aa AA seqDB search
MLVFDSGVGGLSVYNEIRQLLPDLHYIYAFDNVAFPYGEKSEEFIVERVVEIVTAVQQRY
PLALAVIACNTASTVSLPALREKFAFPVVGVVPAIKPAARLTANGIVGLLATRGTVKRPY
TRELIDRFANECRIEMLGSAELVELAEAKLHGEAVPLEELRRILRPWLRMQEPPDTVVLG
CTHFPLLAEELQQVMPEGTRFIDSGAAIARRTAWLLEHEAPDAKSNDANKAFCMAITPDT
EQLLPVLQRYGFETLEKLPL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtgtttgattccggcgtcggtgggttgtcggtatataacgagattcggcagctg
ttgccggatctacattatatttatgctttcgataacgttgccttcccctatggcgagaag
agcgaagagtttatcgttgagcgtgttgttgaaatcgtgactgccgttcagcaacgctat
cctctggcgctggcggtcatcgcctgtaataccgccagtaccgtttccctgccagcccta
cgtgaaaagttcgctttcccggtggtcggcgtcgtaccagcgattaaacctgccgcgcgc
ttaacggcgaacggtattgtcggcctgctggcgacgcgcggtaccgtcaagcgtccttat
actcgtgaactcattgaccgctttgccaatgagtgccgcatcgaaatgctgggttccgct
gagctggtggaactggcagaggcgaagctgcacggcgaagcggtaccgttggaagagctg
cgtcgaattctgcgcccgtggctacggatgcaggaaccgcccgatacggtcgtattaggt
tgtacgcacttcccactactggcggaagaactgcaacaggttatgccggaaggaacgcgg
tttatcgattccggcgcggcgattgctcgacgcaccgcctggctgctggagcatgaagcg
ccggatgccaaatcgaatgatgccaataaggctttttgcatggcgattaccccggatact
gaacagcttttacccgttttacagcgttacggctttgaaacgctggaaaaactaccgctt
taa

DBGET integrated database retrieval system