KEGG   Klebsiella aerogenes EA1509E: CCG33009Help
Entry
CCG33009          CDS       T02447                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
ear  Klebsiella aerogenes EA1509E
Pathway
ear03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ear00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CCG33009
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ear03011]
    CCG33009
Ribosome [BR:ear03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CCG33009
  Bacteria
    CCG33009
  Archaea
    CCG33009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CCG33009
Position
4387445..4387777
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgctcagaaggttcgccttgta
gctgacctgattcgcggtaagaaagtgtcgcaggccctggatattctgacctacaccaac
aaaaaagctgctgtactggtcaagaaggtactggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgatgatctgaaagttgcgaaaattttcgtagacgaaggcccg
agcatgaagcgcattatgccgcgtgctaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacatcactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system