KEGG   Klebsiella aerogenes EA1509E: CCG33538Help
Entry
CCG33538          CDS       T02447                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase (EC 2.3.1.16); Acetyl-CoA acetyltransferase (EC 2.3.1.9)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ear  Klebsiella aerogenes EA1509E
Pathway
ear00071  Fatty acid degradation
ear00072  Synthesis and degradation of ketone bodies
ear00280  Valine, leucine and isoleucine degradation
ear00310  Lysine degradation
ear00362  Benzoate degradation
ear00380  Tryptophan metabolism
ear00620  Pyruvate metabolism
ear00630  Glyoxylate and dicarboxylate metabolism
ear00640  Propanoate metabolism
ear00650  Butanoate metabolism
ear00900  Terpenoid backbone biosynthesis
ear01100  Metabolic pathways
ear01110  Biosynthesis of secondary metabolites
ear01120  Microbial metabolism in diverse environments
ear01130  Biosynthesis of antibiotics
ear01200  Carbon metabolism
ear01212  Fatty acid metabolism
ear02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ear00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCG33538
   00630 Glyoxylate and dicarboxylate metabolism
    CCG33538
   00640 Propanoate metabolism
    CCG33538
   00650 Butanoate metabolism
    CCG33538
  Lipid metabolism
   00071 Fatty acid degradation
    CCG33538
   00072 Synthesis and degradation of ketone bodies
    CCG33538
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCG33538
   00310 Lysine degradation
    CCG33538
   00380 Tryptophan metabolism
    CCG33538
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCG33538
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCG33538
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CCG33538
Enzymes [BR:ear01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CCG33538
Exosome [BR:ear04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCG33538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CCG33538
Position
4901513..4902691
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTPIGCFQGTLARHSAVELGSVVVKALVERSGIDPQCIDEVILGQVLTAG
TGQNPARQSAIRGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAWAL
SSQQKARRAIDSGRFRDEIVPVATEHNGSQRLVDTDEQPRMDASAEGLASLMPTFDQLGS
VTAGNASSINDGAAAVMMMSESKAQELGLPILARIRAFASVGVDPALMGIAPVHATRRCL
ERAGWQLDEVDLIEANEAFAAQAISVGRVLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMIKRDARKGLATLCIGGGQGVALAVERA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtgatcgtcggcgcgttgcgtacgcctatcggctgttttcagggaacg
ctggcgcgtcactcggcggtggaattgggcagcgtggtggtgaaggcgttagtcgagcgg
agcggaatcgatccgcagtgcattgatgaagtgatcctcggtcaggtgctgactgcgggc
accgggcagaatccggcgcgtcagtcggcgatccgcggcgggctgccgaataccgtttcg
gctatcaccatcaacgacgtttgcggctccgggctgaaagcgctgcacctggcgactcag
gccatccaatgcggcgaagcggatgtagtgatcgccggcggccaggaaaacatgagccgc
gcgccgcatgtgcttaccgacagccgaaccggcgcgcagctgggcaatagccagcttatc
gacagcctggtgcatgatgggctgtgggacgctttcaatgactaccatatgggcgtaacg
gcggaaaatctggcgcgggagtatgggatcagccgtgaactacaggacgcctgggcgctt
agctcgcagcaaaaagcgcggcgggcgatagactccgggcggtttcgcgatgaaatcgtg
ccggtcgccaccgagcataacggcagtcaacggctggtggataccgacgagcagccgcgg
atggatgccagcgctgaagggttagccagcctgatgcccaccttcgaccagcttgggtcg
gtgaccgcgggtaatgcatcgagtattaacgatggcgcggcggcggtaatgatgatgagc
gaatcaaaggcccaggagctggggctgccgattctggcgcgcattcgcgccttcgccagc
gtcggcgtcgatccggcgctaatgggtattgccccggtacatgctacccggcgctgcctt
gagcgcgcgggctggcagctggatgaggttgacttaatcgaagctaatgaagcttttgcc
gcccaggcgatctccgttggcagagtgctggagtgggatgaacggcgggttaacgtaaac
ggcggggctatcgccctgggccatccgattggcgcgtccggctgccgtattctggtgtcg
ctggtacatgaaatgatcaagcgcgatgcgcgtaaagggctcgcgacgctgtgtatcggc
ggcggtcagggcgttgcgctggcggtggagcgcgcataa

DBGET integrated database retrieval system