KEGG   Enterobacter asburiae LF7a: Entas_0381Help
Entry
Entas_0381        CDS       T01604                                 

Definition
(GenBank) MscS Mechanosensitive ion channel
  KO
K22051  miniconductance mechanosensitive channel
Organism
eas  Enterobacter asburiae LF7a
Brite
Transporters [BR:eas02000]
 Other Transporters
  Pores ion channels [TC:1]
   Entas_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MscS_TM MscS_porin MS_channel
Motif
Other DBs
NCBI-ProteinID: AEN63135
UniProt: G2S1M8
Position
complement(408298..411621)
Genome map
AA seq 1107 aa AA seqDB search
MRPIIVLLMAWCLSMGAYAATAPDAKQITQELEQAKAAKPAQPETVESLQAALNALEERK
GSLERAQQYQQVIDNFPKLSQTLRSQLNNLRDEPREVPAGMTSDALNQEILQVSSQLLEK
SRMAQQEQERAREIADSLNQLPQQQTDARRQLSEVERRVGTQTGNTPLNQAQNLAIQAES
ARLKALVDELELAQLSANNRQELSRMRSELAQKQSEQLDAWLQTLRNQLNSQRQREAEKA
LESTELLAENSDNLPVGIVDQFKVNRELSAALNQQAQRMDLVASQQRQATNQTLQVRQAL
NTLREQSQWLGSSNLLGEALRAQVARLPEMPKPQQLDTEMAQLRVQRLHFEDLLNKQPQI
RQIRQADGQPLTSEQNRILDAQMRTQRELLNSLLQGGDTLILELTKLKVSNSQLEDALKE
VNEATHRYLFWTSDVRPMTFSWPIEIVQDLRRLISLDTFSQLGQASVMMLTSKETIFPLL
GALILVGCSIYSRRHFTRFLERSSARVGKVTQDHFWLTLRTVFWSILVASPLPVLWMTLG
YGLREAWPYPLAVAIGDGVTATVPLLWVVMICATFARPNGLFIAHFGWPRNRVARAMRYY
LMSIGLIVPLIMALIMFDNLNDREFSGSLGRLCFMLICGALAMVKLSLKRAGIPLYLDKT
GSGDNMFNRLLWNLMLSAPLLAILAAAVGYLATAQALLARLETSVAIWFLLLVVYHVIRR
WMLIQRRRLAFDRAKHRRAEILAQRARGEEESHHTNSTEGNTDADDVELDLDAISTQSLR
LVRSILMLIALLSVIFLWSEIHSAFGFLENISLWDVTSTVQGVESLEPITLGAVLIAILV
LIITTQLIRNFPALLELALLQHLDLAPGTGYAITTITKYLIMLFGGLVGFSMIGIEWSKL
QWLVAALTVGLGFGLQEIFANFVSGLIILFEKPIRIGDTVTIRDLTGSVTRINTRATTIS
DWDRKEIIVPNKAFITEQFINWSLSDSVTRVVLTVPAPSDANSEEVTQILYTAAERCSLV
IDNPAPEVFLVDLQQGIQIFELRIYAAEMGHRMPLRHEIHQLILAGFREHGIDMPFPPFQ
MRLESLDGRKTARTVTSAARKRPAGSL
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcccgattatcgtactactgatggcctggtgcctcagcatgggggcgtacgcagcg
acagcccccgacgccaaacagataacccaggagctggagcaggcaaaagcggcaaaaccc
gcgcagcctgaaaccgtcgaatcgctccaggccgcgctgaacgcgctcgaggaacgcaaa
ggttcccttgagcgtgctcagcaatatcagcaggttatcgataacttccccaaactttcg
caaacgctgcgctcgcagttgaataacctgcgcgatgaaccgcgcgaggtgcctgcgggc
atgacctccgacgcgcttaatcaggagatcctgcaagtcagcagccagcttctggaaaag
agtcgtatggctcagcaggagcaggagcgcgcacgtgaaattgccgattcgctcaaccag
cttccacaacagcaaaccgatgcccgccgccagctcagtgaagttgagcgacgtgtcggg
acacagaccggtaataccccgcttaaccaggcgcagaatcttgccattcaggctgaatcc
gccagactcaaagccctggtggatgagctggagctggcgcaactgtctgccaacaaccgc
caggagctgtcgcggatgcgttccgagctggcgcaaaagcagagtgagcagcttgatgcc
tggttacagaccctgcgtaaccagctaaacagccagcgccagcgtgaagctgaaaaagcg
ctggaaagcacggaattacttgccgaaaacagcgataacctgcccgtcgggattgtcgat
cagtttaaggttaaccgcgagctttctgccgccctgaaccagcaagcacagcgtatggat
ctggtggcgtcgcaacagcgtcaggccactaaccaaaccttgcaggtacgtcaggcgctg
aataccctgcgcgagcaatcccagtggcttggctcctcaaacctgctgggcgaagcatta
cgcgcgcaggttgcacgcttgccggaaatgccaaagccacaacagcttgatactgaaatg
gcacaactgcgcgtccagcgcctgcattttgaagatctcctcaacaaacagccgcaaatc
cgccagatccgtcaggccgacgggcagccgctgaccagtgagcaaaaccgcattctggac
gcgcagatgcgcacccaacgcgagctgctgaattcactgcttcagggtggcgatacgctt
atcctcgagctcaccaagctgaaagtgtctaacagccagcttgaagatgcgctgaaagag
gtgaacgaggcgacgcaccgctacctgttctggacttccgacgtccgcccgatgaccttc
tcctggccaattgaaatcgtgcaggatctgcgccgccttatttcactggataccttcagc
cagttgggccaggccagcgtgatgatgctcaccagcaaagagacgatcttcccgctgctg
ggggcattgattctggtgggttgcagtatttattcgcgcaggcactttacccgcttcctg
gagcgctccagtgcgcgcgtcggcaaggtgacgcaggatcacttctggctaacgctacgc
acggtattctggtcgattctcgttgcctcgccgctgccggtgctgtggatgacgctcggc
tacggcctgcgggaggcctggccttatccgctggcggtggcgattggcgatggtgtgacc
gccaccgttccgctgctgtgggtggtgatgatttgcgccacgtttgcccgtccgaacggc
ctgttcatagcccactttggctggccgcggaatcgcgtggcgcgcgccatgcgttattac
ctgatgagcatcgggcttatcgtgcctctgatcatggcgcttatcatgttcgataacctc
aatgaccgtgaattctccggctcgttgggtcgtctgtgctttatgctgatttgcggcgcg
ctggcgatggttaagctcagcctcaaacgtgccggtattccgctgtatctcgataaaacc
ggcagcggcgataacatgttcaaccgcctgctgtggaacctgatgctctctgctccactg
ctcgcgatcctggcggcagccgtgggttatctggctactgcgcaggcgctgctggcgcgg
ctggaaacgtcagtcgccatctggttcctgctcctggtggtctaccacgttattcgccga
tggatgcttatccagcgccgcaggctggcgttcgaccgtgccaagcaccgccgcgcggag
atcctcgcgcagcgtgcccgaggtgaagaggaatcgcaccataccaacagcacggaaggg
aacaccgatgcggatgatgttgaactggatctcgatgctatcagtacccagtccctgcga
ctggtacgctcgatcctgatgctgattgccctgctctcggtgattttcctgtggtctgag
atccactctgcatttggcttcctcgaaaacatctcgctgtgggatgtcacgtcgacggta
cagggtgttgaaagccttgagcctatcaccctgggcgcggtgctgattgcgattctggtg
ctgatcatcaccacgcagcttatccgtaacttccctgctctgctggaactggcgctgctg
caacacctggatttagcgccaggtacgggctatgccattaccaccatcaccaaatatctg
atcatgctgtttggtgggctggttgggttctcgatgattggtattgagtggtcgaagcta
cagtggctggttgctgccctcaccgttggcctgggctttggcttgcaggagattttcgcc
aactttgtttccggcctgatcatcctgtttgaaaaaccgatccgtatcggcgatacggtg
acgatccgcgacttgaccggcagtgtcaccaggatcaacacccgtgcgacgacgatcagc
gactgggatcgtaaagagatcatcgtgccaaataaggcgtttatcaccgagcagtttatc
aactggtcgttgtcagactccgttacgcgtgtggtgctgaccgtgcctgcgccatcagat
gcaaacagcgaagaggtgacgcaaatcctgtacaccgccgcagagcgctgctcgctggtg
atagacaacccggcaccggaagtcttcctggtcgatttgcagcaggggatccagattttc
gagctgcgtatttatgcggctgaaatggggcatcgaatgccgctgcgccacgagatccac
cagctgattctggcaggcttccgcgagcacggtatcgatatgccgttccctccattccag
atgcgcctggaaagtctggatggtcgtaagacggcaagaacggtgacatcagcggcgcgt
aagcgcccggcgggaagtttgtag

DBGET integrated database retrieval system