KEGG   Enterobacter asburiae LF7a: Entas_1205Help
Entry
Entas_1205        CDS       T01604                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00020  Citrate cycle (TCA cycle)
eas00310  Lysine degradation
eas01100  Metabolic pathways
eas01110  Biosynthesis of secondary metabolites
eas01120  Microbial metabolism in diverse environments
eas01130  Biosynthesis of antibiotics
eas01200  Carbon metabolism
Module
eas_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eas_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Entas_1205
  Amino acid metabolism
   00310 Lysine degradation
    Entas_1205
Enzymes [BR:eas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Entas_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: AEN63951
UniProt: G2S2R5
Position
1314699..1315925
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVKRDEVLVEIETDKVVLEVPASADGVLDAV
LEDEGTTVTSRQILGRLREGNSAGKESSAKSDEKASTPAQRQQASLEEQSNDALSPAIRR
LLAEHNLDAAAIKGTGVGGRLTREDIEKHLAKAPAKAEAEAKAPAAAPAAQPALGARSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGIRLGFMSF
YVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEK
NIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VDGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgaatctgtagcagatgcgactgtc
gccacctggcacaaaaaaccgggcgatgccgttaagcgcgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcttcggcggatggcgttctggatgcagtg
ctggaagatgaaggcaccaccgtaacctctcgtcagatcctgggtcgcctgcgtgaaggc
aacagcgcgggcaaagagtccagcgctaagtctgatgagaaagcctctaccccagcgcag
cgtcagcaggcctctctggaagagcagagcaacgatgcactcagcccggcgatccgtcgc
ctgctggctgagcacaacctggacgcggctgccattaaaggcaccggtgtgggtggtcgt
ctgactcgcgaagacattgagaaacacctggcgaaagcgcctgcgaaagcggaagcagaa
gccaaagcccctgcggcagcgccagcggcacagcctgctctgggcgcacgcagtgaaaaa
cgcgtaccgatgactcgtctgcgtaagcgtgtggctgagcgtctgctggaagcgaaaaac
tccaccgcgatgctgaccaccttcaacgaagtgaacatgaagccaatcatggacctgcgt
aagcagtacggtgacgcgtttgaaaaacgtcacggtatccgtctgggctttatgtccttc
tacgtaaaagcggttgttgaagcgctgaaacgctacccggaagtgaacgcgtctatcgat
ggcgatgacgtggtttaccacaactatttcgacgtcagcatggcggtttctaccccacgt
ggcctggtaacgccagttctgcgtgatgtggataccctgggtatggcagacatcgagaaa
aatattaaagagctggcagtgaaaggccgtgatggcaagctgactgtagacgacctgacc
ggcggtaacttcaccattaccaacggcggtgtattcggttcactgatgtctacgccgatc
atcaacccaccgcagagcgcgatcctggggatgcacgccatcaaagatcgtccgatggcg
gtagacggtaaagttgagatcctgccaatgatgtatctggcgctctcttacgatcaccgt
ctgatcgatggccgcgagtccgtcggcttcctggtagccattaaagagctgctggaagat
ccaacgcgtctgctgctcgacgtctag

DBGET integrated database retrieval system